.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m71

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Plant SLAC1 homolog TehA. To be Published
    Site NYCOMPS
    PDB Id 3m71 Target Id GO.11668
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS31546, Molecular Weight 33017.97 Da.
    Residues 286 Isoelectric Point 5.45
    Sequence mknelicykqmpvwtkdnlpqmfqekhntkvgtwgkltvlkgklkfyeltengdviaehiftpeshipf vepqawhrvealsddlectlgfyckkedyfskkynttaihgdvvdaakiispckvldlgcgqgrnslyl sllgydvtswdhnensiaflnetkekenlnistalydinaaniqenydfivstvvfmflnrervpsiik nmkehtnvggynlivaamstddvpcplpfsftfaenelkeyykdwefleynenmgelhktdengnrikm kfatmlarkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.160
    Matthews' coefficent 3.43 Rfactor 0.141
    Waters 218 Solvent Content 64.13

    Ligand Information
    Ligands BOG (B-OCTYLGLUCOSIDE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch