.
The Open Protein Structure Annotation Network
PDB Keyword
.

1b54

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a yeast hypothetical protein selected by a structural genomics approach. Acta Crystallogr.,Sect.D 59 127-135 2003
    Site NYSGXRC
    PDB Id 1b54 Target Id NYSGXRC-P007
    Related PDB Ids 1ct5 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8060,P38197 Molecular Weight 29121.68 Da.
    Residues 257 Isoelectric Point 6.03
    Sequence mstgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydhgvrefge nyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesrakfqpdcnpil cnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswnvshedskenrdfatlvewkk kidakfgtslklsmgmsadfreairqgtaevrigtdifgarppknearii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.3030000
    Matthews' coefficent 2.50 Rfactor 0.2350000
    Waters 162 Solvent Content 52.00

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1b54
    1. Protein production by auto-induction in high-density shaking cultures
    FW Studier - Protein expression and purification, 2005 - Elsevier
     
    2. Structural genomics: beyond the human genome project
    SK Burley, SC Almo, JB Bonanno, M Capel - Nature , 1999 - primate.or.kr
     
    3. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    4. Determination of protein function, evolution and interactions by structural genomics
    SA Teichmann, AG Murzin, C Chothia - Current opinion in structural biology, 2001 - Elsevier
     
    5. Biological function made crystal clear--annotation of hypothetical proteins via structural genomics
    E Eisenstein, GL Gilliland, O Herzberg, J Moult - Current Opinion in , 2000 - Elsevier
     
    6. Prediction of catalytic residues in enzymes based on known tertiary structure, stability profile, and sequence conservation
    M Ota, K Kinoshita, K Nishikawa - Journal of molecular biology, 2003 - Elsevier
     
    7. Comparison of protein active site structures for functional annotation of proteins and drug design
    R Powers, JC Copeland, K Germer - PROTEINS: , 2006 - Wiley Online Library
     
    8. Crystal structure of YbaK protein from Haemophilus influenzae (HI1434) at 1.8 resolution: functional implications
    H Zhang, K Huang, Z Li, L Banerjei - Proteins: Structure, , 2000 - Wiley Online Library
     
    9. Locating the stabilizing residues in (_/_) 8 barrel proteins based on hydrophobicity, long_range interactions, and sequence conservation
    MM Gromiha, G Pujadas, C Magyar - Proteins: Structure, , 2004 - Wiley Online Library
     
    10. Kinetic and structural characterization of Slr0077/SufS, the essential cysteine desulfurase from Synechocystis sp. PCC 6803
    B Tirupati, JL Vey, CL Drennan, JM Bollinger Jr - Biochemistry, 2004 - ACS Publications
     
    11. Structures of the Escherichia coli PutA proline dehydrogenase domain in complex with competitive inhibitors
    M Zhang, TA White, JP Schuermann, BA Baban - Biochemistry, 2004 - ACS Publications
     
    12. Structural similarity to link sequence space: new potential superfamilies and implications for structural genomics
    P Aloy, B Oliva, E Querol, FX Aviles - Protein science, 2002 - Wiley Online Library
     
    13. Clusters in _/_ barrel proteins: Implications for protein structure, function, and folding: A graph theoretical approach
    N Kannan, S Selvaraj, MM Gromiha - Proteins: Structure, , 2001 - Wiley Online Library
     
    14. Structure of a yeast hypothetical protein selected by a structural genomics approach
    S Eswaramoorthy, S Gerchman, V Graziano - Section D: Biological , 2002 - scripts.iucr.org
     
    15. Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches
    BV Strokopytov, A Fedorov, NM Mahoney - Section D: Biological , 2005 - scripts.iucr.org
     
    16. Stochastic algorithm for kinase homology model construction
    A Rayan, E Noy, D Chema, A Levitzki - Current medicinal , 2004 - ingentaconnect.com
     
    17. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    18. A review of MED-SuMo applications
    O Doppelt-Azeroual, F Moriaud - Infectious , 2009 - alexandre.debrevern.free.fr
     
    19. Exploring the environmental preference of weak interactions in (_/_) 8 barrel proteins
    S Chakkaravarthi, MM Babu - PROTEINS: , 2006 - Wiley Online Library
     
    20. Sequence and structure continuity of evolutionary importance improves protein functional site discovery and annotation
    AD Wilkins, R Lua, S Erdin, RM Ward - Protein , 2010 - Wiley Online Library
     
    21. Dveloppement d'une nouvelle mthode performante de classification des surfaces protiques d'interaction. Optimisations et extensions du logiciel MED-SuMo.
    O Doppelt-Azeroual - 2009 - hal-univ-diderot.archives-ouvertes.fr
     
    22. Efficient Loop Selections Using an Energy Function Based on Bayesian Theorem
    S Xiaohong - Procedia Environmental Sciences, 2011 - Elsevier
     
    23. Protein design: From in silico to in vivo
    AB Chowdry - 2008 - books.google.com
     
    24. 1 INFORMATION ABOUT PROTEIN FUNCTION IS KEY TO DRUG DISCOVERY
    SM Baxter, S Knutson, JS Fetrow - : Determination, Analysis and , 2003 - books.google.com
     
    25. Olivia Doppelt-Azeroual
    C Daveu, SAE Modlisateur - hal.inria.fr
     
    26. Molecular evolution of alanine: glyoxylate aminotransferase intracellular targeting
    JD Holbrook, CJ Danpure - and Molecular Biology of Vitamin B6 , 2000 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch