.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ci0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Structure of PNP Oxidase from S. Cerevisiae. To be Published
    Site NYSGXRC
    PDB Id 1ci0 Target Id NYSGXRC-P008
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8062,P38075 Molecular Weight 26906.88 Da.
    Residues 228 Isoelectric Point 6.94
    Sequence mtkqaeetqkpiifapetyqydkftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgr vssrillfkeldhrgftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfk trprgskigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrpsrlh drfvyrrktendpwkvvrlap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2740000
    Matthews' coefficent 2.40 Rfactor 0.2250000
    Waters 32 Solvent Content 48.00

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     
    Google Scholar output for 1ci0
    1. Structural genomics: beyond the human genome project
    SK Burley, SC Almo, JB Bonanno, M Capel - Nature , 1999 - primate.or.kr
     
    2. Evaluation of protein fold comparison servers
    M Novotny, D Madsen - : Structure, Function, and , 2004 - Wiley Online Library
     
    3. Identification, analysis, and prediction of protein ubiquitination sites
    P Radivojac, V Vacic, C Haynes - Proteins: Structure, , 2010 - Wiley Online Library
     
    4. NMR structure and binding studies confirm that PA4608 from Pseudomonas aeruginosa is a PilZ domain and ac_di_GMP binding protein
    TA Ramelot, A Yee, JR Cort, A Semesi - Proteins: Structure, , 2007 - Wiley Online Library
     
    5. 3D-QSAR study for DNA cleavage proteins with a potential anti-tumor ATCUN-like motif
    H Gonzlez-Daz, Snchez-Gonzlez - Journal of inorganic , 2006 - Elsevier
     
    6. Structure and mechanism of Escherichia coli pyridoxine 5'-phosphate oxidase
    ML di Salvo, MK Safo, FN Musayev, F Bossa - et Biophysica Acta (BBA , 2003 - Elsevier
     
    7. The crystal structure of CREG, a secreted glycoprotein involved in cellular growth and differentiation
    M Sacher, A Di Bacco, VV Lunin, Z Ye - Proceedings of the , 2005 - National Acad Sciences
     
    8. X-ray structure of Escherichia coli pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 2.0 resolution1
    MK Safo, FN Musayev, ML di Salvo - Journal of molecular , 2001 - Elsevier
     
    9. Crystal structure of a putative pyridoxine 5__phosphate oxidase (Rv2607) from Mycobacterium tuberculosis
    JD Pdelacq, BS Rho, CY Kim - PROTEINS: , 2006 - Wiley Online Library
     
    10. Crystal structure of the conserved hypothetical protein Rv1155 from Mycobacterium tuberculosis
    S Canaan, G Sulzenbacher, V Roig-Zamboni - FEBS letters, 2005 - Elsevier
     
    11. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    12. ATCUN_like metal_binding motifs in proteins: Identification and characterization by crystal structure and sequence analysis
    R Sankararamakrishnan, S Verma - Structure, Function, and , 2005 - Wiley Online Library
     
    13. The molecular structure of Rv2074, a probable pyridoxine 5'-phosphate oxidase from Mycobacterium tuberculosis, at 1.6 A resolution
    BK Biswal, K Au, MM Cherney, C Garen - Section F: Structural , 2006 - scripts.iucr.org
     
    14. The Structure-Antituberculosis Activity Relationships Study in a Series of 5-Aryl-2-Thio-1, 3, 4-Oxadiazole Derivatives
    F Macaev, Z Ribkovskaia, S Pogrebnoi - Bioorganic & medicinal , 2011 - Elsevier
     
    15. The molecular structure of Rv2074, a probable pyridoxine 500-phosphate oxidase from
    BK Biswal, K Au, MM Cherney, C Garen - Space, 2006 - pubmedcentralcanada.ca
     
    16. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch