.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ct5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a yeast hypothetical protein selected by a structural genomics approach. Acta Crystallogr.,Sect.D 59 127-135 2003
    Site NYSGXRC
    PDB Id 1ct5 Target Id NYSGXRC-P007
    Related PDB Ids 1b54 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8061,P38197 Molecular Weight 29121.68 Da.
    Residues 257 Isoelectric Point 6.03
    Sequence mstgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydhgvrefge nyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesrakfqpdcnpil cnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswnvshedskenrdfatlvewkk kidakfgtslklsmgmsadfreairqgtaevrigtdifgarppknearii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.245
    Matthews' coefficent 2.58 Rfactor 0.196
    Waters 204 Solvent Content 0.50

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ct5
    1. Determination of protein function, evolution and interactions by structural genomics
    SA Teichmann, AG Murzin, C Chothia - Current opinion in structural biology, 2001 - Elsevier
     
    2. Similar binding sites and different partners: implications to shared proteins in cellular pathways
    O Keskin, R Nussinov - Structure, 2007 - Elsevier
     
    3. Functional attributes of the phosphate group binding cup of pyridoxal phosphate-dependent enzymes1
    AI Denesyuk, KA Denessiouk, T Korpela - Journal of molecular , 2002 - Elsevier
     
    4. Experimental biochemistry
    RL Switzer, LF Garrity - 1999 - books.google.com
     
    5. Data mining the protein data bank: residue interactions
    TJ Oldfield - Proteins: Structure, Function, and Bioinformatics, 2002 - Wiley Online Library
     
    6. Structural similarity to link sequence space: new potential superfamilies and implications for structural genomics
    P Aloy, B Oliva, E Querol, FX Aviles - Protein science, 2002 - Wiley Online Library
     
    7. Structure of a yeast hypothetical protein selected by a structural genomics approach
    S Eswaramoorthy, S Gerchman, V Graziano - Section D: Biological , 2002 - scripts.iucr.org
     
    8. Phosphate group binding
    AI Denesyuk, KA Denessiouk, T Korpela - et Biophysica Acta (BBA , 2003 - Elsevier
     
    9. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    10. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    11. Solving Protein Structures Using Molecular Replacement Via Protein Fragments
    J Gubbi, M Parker, M Palaniswami - Applications of Fuzzy Sets Theory, 2007 - Springer
     
    12. 1 INFORMATION ABOUT PROTEIN FUNCTION IS KEY TO DRUG DISCOVERY
    SM Baxter, S Knutson, JS Fetrow - : Determination, Analysis and , 2003 - books.google.com
     
    13. The importance of structure-based function annotation to drug discovery
    SM Baxter, S Knutson, JS Fetrow - : determination, analysis and , 2003 - books.google.com
     
    14. IGF-1R BINDING PROTEINS AND ANTAGONISTS
    S Ostergaard, R Pillutla, P Fletcher - US Patent App. 12/ , 2008 - Google Patents
     
    15. Design, characterization and modulation of a novel heme-binding membrane protein
    JM Cordova - 2008 - books.google.com
     
    16. Reprsentation simplifie des protines
    A Annexe - theses.ulb.ac.be
     
    17. Specific binding molecules for scintigraphy, conjugates containing them and therapeutic method for treatment of angiogenesis
    D Neri, L Tarli, F Viti, M Birchler - US Patent App. 11/637,810, 2006 - Google Patents
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch