.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dfc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure, evolutionary conservation, and conformational dynamics of Homo sapiens fascin-1, an F-actin crosslinking protein. J.Mol.Biol. 400 589-604 2010
    Site NYSGXRC
    PDB Id 1dfc Target Id NYSGXRC-P119
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8081,11513471 Molecular Weight 54527.06 Da.
    Residues 493 Isoelectric Point 6.84
    Sequence mtangtaeavqiqfglincgnkyltaeafgfkvnasasslkkkqiwtleqppdeagsaavclrshlgry laadkdgnvtcerevpgpdcrflivahddgrwslqseahrryfggtedrlscfaqtvspaekwsvhiam hpqvniysvtrkryahlsarpadeiavdrdvpwgvdslitlafqdqrysvqtadhrflrhdgrlvarpe patgytlefrsgkvafrdcegrylapsgpsgtlkagkatkvgkdelfaleqscaqvvlqaanernvstr qgmdlsanqdeetdqetfqleidrdtkkcafrthtgkywtltatggvqstassknascyfdiewrdrri tlrasngkfvtskkngqlaasvetagdselflmklinrpiivfrgehgfigcrkvtgtldanrssydvf qlefndgaynikdstgkywtvgsdsavtssgdtpvdfffefcdynkvaikvggrylkgdhagvlkasae tvdpaslwey
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.2680000
    Matthews' coefficent 2.30 Rfactor 0.1840000
    Waters Solvent Content 46.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1dfc
    1. Fascins, and their roles in cell structure and function
    N Kureishy, V Sapountzi, S Prag, N Anilkumar - , 2002 - Wiley Online Library
     
    2. Structural basis of filopodia formation induced by the IRSp53/MIM homology domain of human IRSp53
    TH Millard, G Bompard, MY Heung, TR Dafforn - The EMBO , 2005 - nature.com
     
    3. Crystal structure of the ligand binding suppressor domain of type 1 inositol 1, 4, 5-trisphosphate receptor
    I Bosanac, H Yamazaki, T Matsu-Ura, T Michikawa - Molecular cell, 2005 - Elsevier
     
    4. Identification of common structural features of binding sites in galactose_specific proteins
    MS Sujatha, PV Balaji - Proteins: Structure, Function, and , 2004 - Wiley Online Library
     
    5. Migrastatin analogues target fascin to block tumour metastasis
    L Chen, S Yang, J Jakoncic, JJ Zhang, XY Huang - Nature, 2010 - nature.com
     
    6. Fold recognition and accurate sequencestructure alignment of sequences directing __sheet proteins
    AV McDonnell, M Menke, N Palmer - Proteins: Structure, , 2006 - Wiley Online Library
     
    7. Wrap-and-pack: a new paradigm for beta structural motif recognition with application to recognizing beta trefoils
    M Menke, J King, B Berger - Journal of Computational , 2005 - online.liebertpub.com
     
    8. A three-dimensional model of the human transglutaminase 1: insights into the understanding of lamellar ichthyosis
    KM Boeshans, TC Mueser, B Ahvazi - Journal of molecular modeling, 2007 - Springer
     
    9. Structure, Evolutionary Conservation, and Conformational Dynamics of Homo sapiens Fascin-1, an F-actin Crosslinking Protein
    RS Sedeh, AA Fedorov, EV Fedorov, S Ono - Journal of molecular , 2010 - Elsevier
     
    10. Symmetric structures in the universe of protein folds
    A Guerler, C Wang, EW Knapp - Journal of chemical information , 2009 - ACS Publications
     
    11. Fascin1 is dispensable for mouse development but is favorable for neonatal survival
    Y Yamakita, F Matsumura - Cell motility and the , 2009 - Wiley Online Library
     
    12. Modular Evolution and the Origins of Symmetry: Reconstruction of a Three-Fold Symmetric Globular Protein
    A Broom, AC Doxey, YD Lobsanov, LG Berthin - Structure, 2011 - Elsevier
     
    13. Identification of protein latent periodicities using recurrent correlation analysis
    X Ji, Y Wang, H Wang, M Sun - Journal of theoretical biology, 2008 - Elsevier
     
    14. Novel proteins with antiviral, antineoplastic, and/or immunomodulatory activity
    JR Desjarlais, SA Marshall, Y Mo - US Patent App. 10/ , 2003 - Google Patents
     
    15. Contributions to the analysis of proteins
    KJ Bathe, M Bathe, R Sharifi Sedeh - 2011 - dspace.mit.edu
     
    16. Characterization of phosphorylation sites using 3D structural information
    A Del Bonifro - 2010 - tesi.cab.unipd.it
     
    17. Modelling of Fish Cytokines and their Receptors
    A Koussounadis - 2006 - csd.abdn.ac.uk
     
    18. Accurate Demarcation of Protein Domain Linkers Based on Structural Analysis of Linker Probable Region
    VV Samant, A Hulgeriy, A Valencia's - bioclues.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch