.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f89

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative CN hydrolase from yeast. Proteins 52 283-291 2003
    Site NYSGXRC
    PDB Id 1f89 Target Id NYSGXRC-P018
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8063,P49954 Molecular Weight 32547.48 Da.
    Residues 291 Isoelectric Point 7.09
    Sequence msaskilsqkikvalvqlsgsspdkmanlqraatfieramkeqpdtklvvlpecfnspystdqfrkyse vinpkepstsvqflsnlankfkiilvggtipeldpktdkiyntsiifnedgklidkhrkvhlfdvdipn gisfhesetlspgeksttidtkygkfgvgicydmrfpelamlsarkgafamiypsafntvtgplhwhll arsravdnqvyvmlcsparnlqssyhayghsivvdprgkivaeagegeeiiyaeldpeviesfrqavpl tkqrrfdvysdvnah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.258
    Matthews' coefficent 2.26 Rfactor 0.229
    Waters 117 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1f89
    1. Catalysis in the nitrilase superfamily
    C Brenner - Current opinion in structural biology, 2002 - Elsevier
     
    2. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    3. Statistical analysis and prediction of proteinprotein interfaces
    AJ Bordner, R Abagyan - Proteins: Structure, Function, and , 2005 - Wiley Online Library
     
    4. Post_translational cleavage of recombinantly expressed nitrilase from Rhodococcus rhodochrous J1 yields a stable, active helical form
    RN Thuku, BW Weber, A Varsani, BT Sewell - FEBS Journal, 2007 - Wiley Online Library
     
    5. Microbial nitrilases: versatile, spiral forming, industrial enzymes
    RN Thuku, D Brady, MJ Benedik - Journal of applied , 2009 - Wiley Online Library
     
    6. Crystal structure of a putative CN hydrolase from yeast
    D Kumaran, S Eswaramoorthy - Proteins: Structure, , 2003 - Wiley Online Library
     
    7. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    8. Crystal structure of hypothetical protein PH0642 from Pyrococcus horikoshii at 1.6 resolution
    N Sakai, Y Tajika, M Yao, N Watanabe - Proteins: Structure, , 2004 - Wiley Online Library
     
    9. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories
    TR Ioerger, Y Feng, K Ganesula, X Chen - Journal of , 2010 - Am Soc Microbiol
     
    10. Structure of amidase from Pseudomonas aeruginosa showing a trapped acyl transfer reaction intermediate state
    J Andrade, A Karmali, MA Carrondo - Journal of Biological , 2007 - ASBMB
     
    11. Motif-based protein ranking by network propagation
    R Kuang, J Weston, WS Noble, C Leslie - Bioinformatics, 2005 - Oxford Univ Press
     
    12. Influence of different carboxy-terminal mutations on the substrate-, reaction-and enantiospecificity of the arylacetonitrilase from Pseudomonas fluorescens EBC191
    C Kiziak, J Klein, A Stolz - Protein Engineering Design and , 2007 - Oxford Univ Press
     
    13. Combinatorial docking approach for structure prediction of large proteins and multi-molecular assemblies
    Y Inbar, H Benyamini, R Nussinov, HJ Wolfson - Physical biology, 2005 - iopscience.iop.org
     
    14. The Crystal Structure of _-Alanine Synthase from Drosophila melanogaster Reveals a Homooctameric Helical Turn-Like Assembly
    S Lundgren, B Lohkamp, B Andersen, J Pikur - Journal of molecular , 2008 - Elsevier
     
    15. Structure of an aliphatic amidase from Geobacillus pallidus RAPc8
    SW Kimani, VB Agarkar, DA Cowan - Section D: Biological , 2007 - scripts.iucr.org
     
    16. Oligomeric structure of nitrilases: effect of mutating interfacial residues on activity
    BT Sewell, RN Thuku, X Zhang - Annals of the New York , 2005 - Wiley Online Library
     
    17. Functional Proteomic and Structural Insights into Molecular Recognition in the Nitrilase Family Enzymes
    KT Barglow, KS Saikatendu, MH Bracey, R Huey - Biochemistry, 2008 - ACS Publications
     
    18. Investigative mining of sequence data for novel enzymes: A case study with nitrilases
    JL Seffernick, SK Samanta, TM Louie, LP Wackett - Journal of , 2009 - Elsevier
     
    19. The quaternary structure of the amidase from Geobacillus pallidus RAPc8 is revealed by its crystal packing
    VB Agarkar, SW Kimani, DA Cowan - Section F: Structural , 2006 - scripts.iucr.org
     
    20. The crystal structure of XC1258 from Xanthomonas campestris: a putative procaryotic Nit protein with an arsenic adduct in the active site
    KH Chin, YD Tsai, NL Chan, KF Huang - Proteins: Structure, , 2007 - Wiley Online Library
     
    21. Directed evolution of Alcaligenes faecalis nitrilase
    U Schreiner, B Hecher, S Obrowsky, K Waich - Enzyme and Microbial , 2010 - Elsevier
     
    22. Crystallographic analysis of a thermoactive nitrilase
    JE Raczynska, CE Vorgias, G Antranikian - Journal of structural , 2011 - Elsevier
     
    23. Improved Fitness of Arabidopsis thaliana Nitrilase 2
    U Schreiner, G Steinkellner, JD Rozzell - , 2010 - Wiley Online Library
     
    24. Heterologous expression, purification and characterization of nitrilase from Aspergillus niger K10
    O Kaplan, K Bezouka, O Plhal, R Ettrich - BMC , 2011 - biomedcentral.com
     
    25. Structural and biochemical characterization of a nitrilase from the thermophilic bacterium, Geobacillus pallidus RAPc8
    DS Williamson, KC Dent, BW Weber, A Varsani - Applied microbiology , 2010 - Springer
     
    26. Patch prediction of protein interaction sites: validation of a scoring function for an online server
    S Jones, Y Mukarami - Bioinformatics Research and Development, 2007 - Springer
     
    27. Cloning, crystallization and preliminary X-ray study of XC1258, a CN-hydrolase superfamily protein from Xanthomonas campestris
    YD Tsai, KH Chin, HL Shr, FP Gao, PC Lyu - Section F: Structural , 2006 - scripts.iucr.org
     
    28. Biochemical and Mutational Studies of the Bacillus cereus CECT 5050T Formamidase Support the Existence of a CEEK Tetrad in Several Members of the Nitrilase
    P Soriano-Maldonado, AI Martnez-Gmez - Applied and , 2011 - Am Soc Microbiol
     
    29. _-alanine synthase: one reaction, two folds and mechanisms
    S Lundgren - 2007 - diss.kib.ki.se
     
    30. Supplementary Discussion
    ED Levy, EB Erba, CV Robinson, SA Teichmann - moult.ibbr.umd.edu
     
    31. Modeling Substrate-Enzyme Interactions in Fungal Hydrolases
    N Kulik, N Hrady - theses.cz
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch