.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fi4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of enzymes involved in sterol/isoprenoid biosynthesis. Proc.Natl.Acad.Sci.USA 98 12896-12901 2001
    Site NYSGXRC
    PDB Id 1fi4 Target Id NYSGXRC-P100
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8075,P32377 Molecular Weight 44113.50 Da.
    Residues 396 Isoelectric Point 5.54
    Sequence mtvytasvtapvniatlkywgkrdtklnlptnssisvtlsqddlrtltsaatapeferdtlwlngephs idnertqnclrdlrqlrkemeskdaslptlsqwklhivsennfptaaglassaagfaalvsaiaklyql pqstseisriarkgsgsacrslfggyvawemgkaedghdsmavqiadssdwpqmkacvlvvsdikkdvs stqgmqltvatselfkeriehvvpkrfevmrkaivekdfatfaketmmdsnsfhatcldsfppifymnd tskriiswchtinqfygetivaytfdagpnavlyylaenesklfafiyklfgsvpgwdkkftteqleaf nhqfessnftareldlelqkdvarviltqvgsgpqetneslidaktglpke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.27 Rfree 0.268
    Matthews' coefficent 2.51 Rfactor 0.239
    Waters 164 Solvent Content 51.04

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1fi4
    1. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    2. CASP5 assessment of fold recognition target predictions
    LN Kinch, JO Wrabl, S Krishna - Proteins: Structure, , 2003 - Wiley Online Library
     
    3. Structure of the Methanococcus jannaschii mevalonate kinase, a member of the GHMP kinase superfamily
    D Yang, LW Shipman, CA Roessner, AI Scott - Journal of Biological , 2002 - ASBMB
     
    4. Structuring the universe of proteins
    SK Burley, JB Bonanno - Annual review of genomics and , 2002 - annualreviews.org
     
    5. Crystal structure of 4-(cytidine 5_-diphospho)-2-C-methyl-D-erythritol kinase, an enzyme in the non-mevalonate pathway of isoprenoid synthesis
    T Wada, T Kuzuyama, S Satoh, S Kuramitsu - Journal of Biological , 2003 - ASBMB
     
    6. Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily
    MJ Romanowski, JB Bonanno - : Structure, Function, and , 2002 - Wiley Online Library
     
    7. Structural genomics of proteins from conserved biochemical pathways and processes
    SK Burley, JB Bonanno - Current opinion in structural biology, 2002 - Elsevier
     
    8. Structural genomics
    SK Burley, JB Bonanno - Structural Bioinformatics, 2003 - Wiley Online Library
     
    9. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators
    JG Luz, CA Hassig, C Pickle, A Godzik - Science's , 2003 - stke.sciencemag.org
     
    10. Phasing at resolution higher than the experimental resolution
    R Caliandro, B Carrozzini, GL Cascarano - Section D: Biological , 2005 - scripts.iucr.org
     
    11. Sites for interaction between Gal80p and Gal1p in Kluyveromyces lactis: structural model of galactokinase based on homology to the GHMP protein family
    RA Menezes, C Amuel, R Engels - Journal of molecular , 2003 - Elsevier
     
    12. Molecular functions of conserved aspects of the GHMP kinase family
    JL Andreassi II, TS Leyh - Biochemistry, 2004 - ACS Publications
     
    13. Crystal structures of Trypanosoma brucei and Staphylococcus aureus mevalonate diphosphate decarboxylase inform on the determinants of specificity and reactivity
    E Byres, MS Alphey, TK Smith, WN Hunter - Journal of molecular biology, 2007 - Elsevier
     
    14. Protein docking using surface matching and supervised machine learning
    AJ Bordner, AA Gorin - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    15. Phasing via SAD/MAD data: the method of the joint probability distribution functions
    C Giacovazzo, D Siliqi - Acta Crystallographica Section D: Biological , 2003 - scripts.iucr.org
     
    16. Structural trees for proteins containing _-motifs
    AV Efimov - Biochemistry (Moscow), 2008 - Springer
     
    17. The revenge of the Patterson methods. II. Substructure applications
    MC Burla, R Caliandro, B Carrozzini - Journal of Applied , 2007 - scripts.iucr.org
     
    18. Human mevalonate diphosphate decarboxylase: Characterization, investigation of the mevalonate diphosphate binding site, and crystal structure
    NE Voynova, Z Fu, KP Battaile, TJ Herdendorf - Archives of biochemistry , 2008 - Elsevier
     
    19. GHMP kinases-structures, mechanisms and potential for therapeutically relevant inhibition
    DJ Timson - Current Enzyme Inhibition, 2007 - ingentaconnect.com
     
    20. Formation of Isobutene from 3-Hydroxy-3-Methylbutyrate by Diphosphomevalonate Decarboxylase
    DS Gogerty, TA Bobik - Applied and environmental microbiology, 2010 - Am Soc Microbiol
     
    21. Simulation of structural and functional properties of mevalonate diphosphate decarboxylase (MVD)
    S Weerasinghe, R Samantha Dassanayake - Journal of Molecular , 2010 - Springer
     
    22. Crystal structures of staphylococcus epidermidis mevalonate diphosphate decarboxylase bound to inhibitory analogs reveal new insight into substrate binding and
    ML Barta, DA Skaff, WJ McWhorter - Journal of Biological , 2011 - ASBMB
     
    23. Patch prediction of protein interaction sites: validation of a scoring function for an online server
    S Jones, Y Mukarami - Bioinformatics Research and Development, 2007 - Springer
     
    24. Molecular cloning, characterization and heterologous expression in Saccharomyces cerevisiae of a mevalonate diphosphate decarboxylase cDNA from Ginkgo biloba
    Y Pang, G Shen, T Bergs, H Cardier - Physiologia , 2006 - Wiley Online Library
     
    25. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    26. Backbone 1 H, 13 C, 15 N NMR assignments of the unliganded and substrate ternary complex forms of mevalonate diphosphate decarboxylase from Streptococcus
    G Reuther, R Harris, M Girvin, TS Leyh - Biomolecular NMR Assignments, 2011 - Springer
     
    27. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    28. Structural genomics of enzymes involved in sterol/isoprenoid biosynthesis
    JB Bonanno, C Edo, N Eswar - Proceedings of the , 2001 - National Acad Sciences
     
    29. Structural studies of terpenoid biosynthesis and bacterial cell division
    D Yang - 2006 - repository.tamu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch