.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of ribosome anti-association factor IF6. Nat.Struct.Biol. 7 1156-1164 2000
    Site NYSGXRC
    PDB Id 1g61 Target Id NYSGXRC-P111a
    Molecular Characteristics
    Source Methanococcus jannaschii.
    Alias Ids TPS8080,Q60357 Molecular Weight 24457.80 Da.
    Residues 228 Isoelectric Point 4.53
    Sequence mtmiirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgslsvankyg lllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalispelkdfkkdiedslnve veigtiaelptvgsnavvtnkgclthplveddeleflkslfkveyigkgtankgttsvgaciianskga vvggdttgpelliiedalgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.1790000
    Matthews' coefficent 2.37 Rfactor 0.1320000
    Waters 704 Solvent Content 48.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1g61
    1. SCOP database in 2002: refinements accommodate structural genomics
    LL Conte, SE Brenner, TJP Hubbard - Nucleic Acids , 2002 - Oxford Univ Press
     
    2. Natural _-sheet proteins use negative design to avoid edge-to-edge aggregation
    JS Richardson, DC Richardson - Proceedings of the , 2002 - National Acad Sciences
     
    3. STANDARD TRANSLATION INITIATION IN EUKARYOTES is the process that leads to assembly of an 80S ribosome on an mRNA in which the initiation codon is base
    TV Pestova, JR Lorsch - Translational control in , 2007 - books.google.com
     
    4. A consensus view of fold space: combining SCOP, CATH, and the Dali Domain Dictionary
    R Day, DAC Beck, RS Armen, V Daggett - Protein Science, 2003 - Wiley Online Library
     
    5. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    6. Evaluation of protein fold comparison servers
    M Novotny, D Madsen - : Structure, Function, and , 2004 - Wiley Online Library
     
    7. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    8. Crystal structures of ribosome anti-association factor IF6
    CM Groft, R Beckmann, A Sali, SK Burley - Nature structural biology, 2000 - salilab.org
     
    9. Connectivity independent protein-structure alignment: a hierarchical approach
    B Kolbeck, P May, T Schmidt-Goenner - BMC , 2006 - biomedcentral.com
     
    10. Statistical and conformational analysis of the electron density of protein side chains
    MV Shapovalov, RL Dunbrack Jr - Proteins: Structure, Function , 2007 - Wiley Online Library
     
    11. The role of water molecules in computational drug design
    S De Beer, NPE Vermeulen - Current topics in , 2010 - ingentaconnect.com
     
    12. Rapid estimation of solvation energy for simulations of protein-protein association
    DS Cerutti, F Lynn, JA McCammon - Journal of Chemical Theory , 2005 - ACS Publications
     
    13. Crystal structure of N-succinylarginine dihydrolase AstB, bound to substrate and product, an enzyme from the arginine catabolic pathway of Escherichia coli
    A Tocilj, JD Schrag, Y Li, BL Schneider - Journal of Biological , 2005 - ASBMB
     
    14. Visualization of conformational distribution of short to medium size segments in globular proteins and identification of local structural motifs
    K Ikeda, K Tomii, T Yokomizo, D Mitomo - Protein , 2005 - Wiley Online Library
     
    15. Quantum Chemical Investigations on Intraresidue Carbonyl_ Carbonyl Contacts in Aspartates of High-Resolution Protein Structures
    TK Pal, R Sankararamakrishnan - The Journal of Physical , 2009 - ACS Publications
     
    16. Structural plasticity associated with the [beta]-propeller architecture
    K Guruprasad, P Dhamayanthi - International journal of biological , 2004 - Elsevier
     
    17. Mechanistic similarity and diversity among the guanidine-modifying members of the pentein superfamily
    T Linsky, W Fast - Biochimica et Biophysica Acta (BBA)-Proteins & , 2010 - Elsevier
     
    18. Symmetric structures in the universe of protein folds
    A Guerler, C Wang, EW Knapp - Journal of chemical information , 2009 - ACS Publications
     
    19. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    20. Response to Paoli
    CM Groft, R Beckmann, A Sali, SK Burley - Nature Structural & , 2001 - nature.com
     
    21. The molecular basis of translational control
    CS Fraser - Progress in Molecular Biology and Translational , 2009 - Elsevier
     
    22. Cryo-EM Structure of the Archaeal 50S Ribosomal Subunit in Complex with Initiation Factor 6 and Implications for Ribosome Evolution
    BJ Greber, D Boehringer, V Godinic-Mikulcic - Journal of Molecular , 2012 - Elsevier
     
    23. The automatic detection of known _-propeller structural motifs from protein tertiary structure
    A Kotu, K Guruprasad - International journal of biological macromolecules, 2005 - Elsevier
     
    24. A Benchmark Data Set and Comparative Study for Protein Structural Alignment Tools
    D Mittal - 2008 - etd.ohiolink.edu
     
    25. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    26. Using the CONNJUR Database to Analyze Atomic Bond Characteristics as they Relate to Surface Topology of Protein Molecules
    RE Raupach - ewp.rpi.edu
     
    27. User Interface and Modified Testbench to Support Comprehensive Analysis of Protein Structural Alignment Tools
    P Kamepalli - 2011 - etd.ohiolink.edu
     
    28. A consensus view of fold space: Combining SCOP, CATH, and the
    DD Dictionary - Citeseer
     
    29. Phylogenetics and homology modeling
    AW Smith - 2008 - books.google.com
     
    30. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     
    31. Reprsentation simplifie des protines
    A Annexe - theses.ulb.ac.be
     
    32. Models for solvated biomolecular structures
    D Cerutti - 2007 - escholarship.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch