.
The Open Protein Structure Annotation Network
PDB Keyword
.

1hqz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches. Acta Crystallogr.,Sect.D 61 285-293 2005
    Site NYSGXRC
    PDB Id 1hqz Target Id NYSGXRC-T138
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8104,P15891 Molecular Weight 65572.56 Da.
    Residues 592 Isoelectric Point 4.59
    Sequence malepidytthsreidaeylkivrgsdpdttwliispnakkeyepestgssfhdflqlfdetkvqygla rvsppgsdvekiiiigwcpdsaplktrasfaanfaavannlfkgyhvqvtardeddldenellmkisna agarysiqtsskqqgkastppvkksftpskspapvskkepvktpspapaakissrvndnnddddwnepe lkerdfdqaplkpnqssykpigkidlqkviaeekakedprlvqkptaagskidpssdianlknesklkr dsefnsflgttkppsmtesslkndddkvikgfrnekspaqlwaerkakqnsgnaetkaeapkpevpede pegepdvkdlkskfeglaasekeeeemenkfapppkkseptiispkpfskpqepvkaeeaeqpktdykk ignplpgmhieadneeepeendddwdddedeaaqpplpsrnvasgapvqkeepeqeeiapslpsrnsip apkqeeapeqapeeeieeeaeeaapqlpsrssaappppprratpekkpkenpwataeydydaaednelt fvendkiiniefvdddwwlgelekdgskglfpsnyvslgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.259
    Matthews' coefficent 2.22 Rfactor 0.213
    Waters 516 Solvent Content 43.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1hqz
    1. Intrinsic disorder is a common feature of hub proteins from four eukaryotic interactomes
    C Haynes, CJ Oldfield, F Ji, N Klitgord - PLoS computational , 2006 - dx.plos.org
     
    2. Towards index-based similarity search for protein structure databases
    O amoglu, T Kahveci, AK Singh - Conference, 2003. CSB , 2003 - ieeexplore.ieee.org
     
    3. Structural and functional dissection of the Abp1 ADFH actin-binding domain reveals versatile in vivo adapter functions
    O Quintero-Monzon, AA Rodal - Molecular biology of , 2005 - Am Soc Cell Biol
     
    4. Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches
    BV Strokopytov, A Fedorov, NM Mahoney - Section D: Biological , 2005 - scripts.iucr.org
     
    5. Actin filament remodeling by actin depolymerization factor/cofilin
    J Pfaendtner, EM De La Cruz - Proceedings of the , 2010 - National Acad Sciences
     
    6. Binding model of human coactosin-like protein with filament actin revealed by mutagenesis
    H Dai, W Huang, J Xu, B Yao, S Xiong, H Ding - et Biophysica Acta (BBA , 2006 - Elsevier
     
    7. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    8. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    9. Spherical distance metrics applied to protein structure classification
    J DeFelice - 2011 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch