.
The Open Protein Structure Annotation Network
PDB Keyword
.

1i9a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of enzymes involved in sterol/isoprenoid biosynthesis. Proc.Natl.Acad.Sci.USA 98 12896-12901 2001
    Site NYSGXRC
    PDB Id 1i9a Target Id NYSGXRC-P109a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8078,Q46822 Molecular Weight 20507.18 Da.
    Residues 182 Isoelectric Point 5.94
    Sequence mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwtnsvcgh pqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmd yqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2790000
    Matthews' coefficent 3.26 Rfactor 0.2290000
    Waters 261 Solvent Content 62.31

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 2

    Jmol

     
    Google Scholar output for 1i9a
    1. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    2. Neuro (active) steroids actions at the neuromodulatory sigma 1(_ 1) receptor: Biochemical and physiological evidences, consequences in
    T Maurice, C Grgoire, J Espallergues - Pharmacology Biochemistry and , 2006 - Elsevier
     
    3. Structural genomics of enzymes involved in sterol/isoprenoid biosynthesis
    JB Bonanno, C Edo, N Eswar - Proceedings of the , 2001 - National Acad Sciences
     
    4. Structural genomics of proteins from conserved biochemical pathways and processes
    SK Burley, JB Bonanno - Current opinion in structural biology, 2002 - Elsevier
     
    5. Phasing at resolution higher than the experimental resolution
    R Caliandro, B Carrozzini, GL Cascarano - Section D: Biological , 2005 - scripts.iucr.org
     
    6. Structural Studies of the Nudix Hydrolase DR1025 From Deinococcus radiodurans and its Ligand Complexes
    W Ranatunga, EE Hill, JL Mooster, EL Holbrook - Journal of molecular , 2004 - Elsevier
     
    7. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    8. Phasing via SAD/MAD data: the method of the joint probability distribution functions
    C Giacovazzo, D Siliqi - Acta Crystallographica Section D: Biological , 2003 - scripts.iucr.org
     
    9. Structure-based drug design targeting biosynthesis of isoprenoids: a crystallographic state of the art of the involved enzymes
    J Ruyck, J Wouters - Current Protein and Peptide Science, 2008 - ingentaconnect.com
     
    10. The revenge of the Patterson methods. II. Substructure applications
    MC Burla, R Caliandro, B Carrozzini - Journal of Applied , 2007 - scripts.iucr.org
     
    11. Advances in the EDM-DEDM procedure
    R Caliandro, B Carrozzini, GL Cascarano - Section D: Biological , 2009 - scripts.iucr.org
     
    12. Sequence-based enzyme catalytic domain prediction using clustering and aggregated mutual information content
    K Choi, S Kim - , Imaging and Systems Biology (HISB), 2011 , 2011 - ieeexplore.ieee.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch