.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jd1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1). Proteins 48 431-436 2002
    Site NYSGXRC
    PDB Id 1jd1 Target Id NYSGXRC-P003
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8058,P40037 Molecular Weight 13905.16 Da.
    Residues 129 Isoelectric Point 5.28
    Sequence mvttltpvicesapaaaasyshamkvnnliflsgqipvtpdnklvegsiadkaeqviqniknvleasns sldrvvkvnifladinhfaefnsvyakyfnthkparscvavaalplgvdmemeaiaaerd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.70 Rfree 0.238
    Matthews' coefficent 2.42 Rfactor 0.207
    Waters 634 Solvent Content 49.27

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jd1
    1. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    2. High_resolution prediction of protein helix positions and orientations
    X Li, MP Jacobson, RA Friesner - Proteins: Structure, Function, , 2004 - Wiley Online Library
     
    3. The structure of L-ribulose-5-phosphate 4-epimerase: an aldolase-like platform for epimerization
    Y Luo, J Samuel, SC Mosimann, JE Lee - Biochemistry, 2001 - ACS Publications
     
    4. X_ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1)
    AM Deaconescu, A Roll_Mecak - Proteins: Structure, , 2002 - Wiley Online Library
     
    5. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    6. Crystal structure of the YjgF/YER057c/UK114 family protein from the hyperthermophilic archaeon Sulfolobus tokodaii strain 7
    T Miyakawa, WC Lee, K Hatano, Y Kato - Proteins: Structure, , 2006 - Wiley Online Library
     
    7. Structural and functional roles of coevolved sites in proteins
    S Chakrabarti, AR Panchenko - PloS one, 2010 - dx.plos.org
     
    8. Mutational Analysis of Cvab, an ABC Transporter Involved in the Secretion of Active Colicin V
    KH Wu, YH Hsieh, PC Tai - PloS one, 2012 - dx.plos.org
     
    9. Crystal structure of the PSPTO-PSP protein from Pseudomonas syringae pv. tomato str. DC3000 in complex with d-glucose
    H Zhang, Y Gao, M Li, W Chang - Biochemical and biophysical research , 2010 - Elsevier
     
    10. The interface of protein structure, protein biophysics, and molecular evolution
    DA Liberles, SA Teichmann, I Bahar, U Bastolla - Protein , 2012 - Wiley Online Library
     
    11. Probabilistic Models of Local Biomolecular Structure and Their Applications
    W Boomsma, J Frellsen, T Hamelryck - Bayesian Methods in Structural , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch