.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jfi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex. Cell(Cambridge,Mass.) 106 71-81 2001
    Site NYSGXRC
    PDB Id 1jfi Target Id NYSGXRC-P048a
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8068,Q14919 Molecular Weight 22348.63 Da.
    Residues 205 Isoelectric Point 5.04
    Sequence mpskkkkynarfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrnaktmttsh lkqcieleqqfdflkdlvasvpdmqgdgednhmdgdkgarrgrkpgsggrknggmgtkskdkklsgtds eqedesedtdtdgeeetsqpppqashpsahfqspptpflpfastlplppappgpsapdeedeedyds
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.62 Rfree 0.2770000
    Matthews' coefficent 2.79 Rfactor 0.2330000
    Waters 9 Solvent Content 55.84

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jfi
    1. Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex
    K Kamada, F Shu, H Chen, S Malik, G Stelzer - Cell, 2001 - Elsevier
     
    2. CCAN makes multiple contacts with centromeric DNA to provide distinct pathways to the outer kinetochore
    T Hori, M Amano, A Suzuki, CB Backer, JP Welburn - Cell, 2008 - Elsevier
     
    3. An accurate, sensitive, and scalable method to identify functional sites in protein structures
    H Yao, DM Kristensen, I Mihalek, ME Sowa - Journal of molecular , 2003 - Elsevier
     
    4. 3D_SHOTGUN: A novel, cooperative, fold_recognition meta_predictor
    D Fischer - Proteins: Structure, Function, and Bioinformatics, 2003 - Wiley Online Library
     
    5. A hint to search for metalloproteins in gene banks
    C Andreini, I Bertini, A Rosato - Bioinformatics, 2004 - Oxford Univ Press
     
    6. Eukaryotic transcription factors
    AJ Warren - Current opinion in structural biology, 2002 - Elsevier
     
    7. Ab initio prediction of peptide_MHC binding geometry for diverse class I MHC allotypes
    AJ Bordner, R Abagyan - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    8. On the origin of the histone fold
    V Alva, M Ammelburg, J Sding - BMC structural biology, 2007 - biomedcentral.com
     
    9. CENP-TWSX Forms a Unique Centromeric Chromatin Structure with a Histone-like Fold
    T Nishino, K Takeuchi, KE Gascoigne, A Suzuki, T Hori - Cell, 2012 - Elsevier
     
    10. Rank information: A structure_independent measure of evolutionary trace quality that improves identification of protein functional sites
    H Yao, I Mihalek, O Lichtarge - Proteins: Structure, Function, , 2006 - Wiley Online Library
     
    11. Structure and mechanism of the Swi2/Snf2 remodeller Mot1 in complex with its substrate TBP
    P Wollmann, S Cui, R Viswanathan, O Berninghausen - Nature, 2011 - nature.com
     
    12. Asymmetry in the burial of hydrophobic residues along the histone chains of Eukarya, Archaea and a transcription factor
    BD Silverman - BMC structural biology, 2005 - biomedcentral.com
     
    13. Hidden Markov Modelle fr Einzelmolekldaten
    N Zarrabi - 2010 - elib.uni-stuttgart.de
     
    14. Untersuchung der Funktion und Dynamik von DNA-Transkriptionsfaktoren mittels Einzelmolekl-Fluoreszenzmikroskopie
    P Schlsche - 2007 - edoc.ub.uni-muenchen.de
     
    15. Characterization of alpha helices interacting with nucleic acids
    R Sreekanth, V Pattabhi, SS Rajan - Computational Biology and Chemistry, 2008 - Elsevier
     
    16. Improving Prediction Accuracy of Protein-DNA Docking with GPU Computing
    B Hong, J Wu, J Guo - Bioinformatics and Biomedicine (BIBM), , 2011 - ieeexplore.ieee.org
     
    17. Sequence and structural analyses of nuclear export signals in the NESdb database
    D Xu, A Farmer, G Collett, NV Grishin - Molecular Biology of , 2012 - Am Soc Cell Biol
     
    18. Equilibrium study of Protein/DNA Complexes from Crystal Structure Data
    S Samanta, J Chakrabarti, D Bhattacharyya - Arxiv preprint physics/ , 2006 - arxiv.org
     
    19. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     
    20. Proteinnucleic acid recognition: statistical analysis of atomic interactions and influence of DNA structure
    D Lejeune, N Delsaux, B Charloteaux - Proteins: Structure, , 2005 - Wiley Online Library
     
    21. A Preliminary Study-Analysis of Three-Conformation and Biochemical Function of the Stem Cell Regulatory Protein & DNA
    YC Hsu - 2002 - etdncku.lib.ncku.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch