.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jg8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Low-specificity Threonine Aldolase, a Key Enzyme in Glycine Biosynthesis. To be published
    Site NYSGXRC
    PDB Id 1jg8 Target Id NYSGXRC-P044a
    Related PDB Ids 1lw5 1lw4 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8065,Q9X266 Molecular Weight 37572.08 Da.
    Residues 343 Isoelectric Point 6.23
    Sequence midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtmgnqvsimah tqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkairprnihfprtsliaienth nrsggrvvplenikeictiakehginvhidgarifnasiasgvpvkeyagyadsvmfclskglcapvgs vvvgdrdfierarkarkmlgggmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnped vktnmvilrtdnlkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.222
    Matthews' coefficent 2.36 Rfactor 0.207
    Waters 841 Solvent Content 47.85

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2;CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 1jg8
    1. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    2. Evolutionarily conserved regions and hydrophobic contacts at the superfamily level: The case of the fold_type I, pyridoxal_5__phosphate_dependent enzymes
    A Paiardini, F Bossa, S Pascarella - Protein science, 2004 - Wiley Online Library
     
    3. X-ray structures of threonine aldolase complexes: structural basis of substrate recognition
    CL Kielkopf, SK Burley - Biochemistry, 2002 - ACS Publications
     
    4. Phosphate group binding
    AI Denesyuk, KA Denessiouk, T Korpela - et Biophysica Acta (BBA , 2003 - Elsevier
     
    5. DOCTOR OF PHILOSOPHY in BIOMOLECULAR ENGINEERING
    A Fyfe - 2012 - compbio.soe.ucsc.edu
     
    6. Of sequence and structure: Strategies of protein thermostability in evolutionary perspective
    IN Berezovsky, EI Shakhnovich - Arxiv preprint q-bio/0408007, 2004 - arxiv.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch