.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jss

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Mus musculus cholesterol-regulated START protein 4 (StarD4) containing a StAR-related lipid transfer domain. Proc.Natl.Acad.Sci.USA 99 6949-6954 2002
    Site NYSGXRC
    PDB Id 1jss Target Id NYSGXRC-T526
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS8111,Q99JV5 Molecular Weight 25577.76 Da.
    Residues 224 Isoelectric Point 5.45
    Sequence madpespwsqigrkikleglsdvasistklqntliqyhsikedewrvakkvkdvtvwrkpseefngyly kaqgvmddvvnnvidhirpgpwrldwdrlmtsldvlehfeenccvmryttagqllniisprefvdfsyt vgyeegllscgvsvewsetrpefvrgynhpcgwfcvplkdspsqslltgyiqtdlrgmipqsavdtama stlanfysdlrkglrka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2850000
    Matthews' coefficent 2.35 Rfactor 0.2380000
    Waters 290 Solvent Content 47.71

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jss
    1. Crystal structure of the Mus musculus cholesterol-regulated START protein 4 (StarD4) containing a StAR-related lipid transfer domain
    MJ Romanowski, RE Soccio - Proceedings of the , 2002 - National Acad Sciences
     
    2. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    3. StAR-like activity and molten globule behavior of StARD6, a male germ-line protein
    S Himangshu, RM Whittal, Y Ran, M Bose - Biochemistry, 2008 - ACS Publications
     
    4. Structure of a yellow lupin pathogenesis-related PR-10 protein belonging to a novel subclass
    O Pasternak, J Biesiadka, R Dolot - Section D: Biological , 2004 - scripts.iucr.org
     
    5. Structural insight into the self-sacrifice mechanism of enediyne resistance
    S Singh, MH Hager, C Zhang, BR Griffith, MS Lee - 2006 - ACS Publications
     
    6. VASP: a volumetric analysis of surface properties yields insights into protein-ligand binding specificity
    BY Chen, B Honig - PLoS computational biology, 2010 - dx.plos.org
     
    7. Mammalian StAR-related lipid transfer (START) domains with specificity for cholesterol: structural conservation and mechanism of reversible binding
    P Lavigne, R Najmanivich, JG LeHoux - Cholesterol Binding and , 2010 - Springer
     
    8. NMR structure of the 18 kDa protein CC1736 from Caulobacter crescentus identifies a member of the START domain superfamily and suggests residues mediating
    Y Shen, S Goldsmith_Fischman - Proteins: Structure, , 2005 - Wiley Online Library
     
    9. Efficient recognition of protein fold at low sequence identity by conservative application of Psi_BLAST: validation
    FJ Stevens - Journal of Molecular Recognition, 2005 - Wiley Online Library
     
    10. Comparative structural analysis of lipid binding START domains
    AG Thorsell, WH Lee, C Persson, MI Siponen - PloS one, 2011 - dx.plos.org
     
    11. High-throughput computational structure-based characterization of protein families: START domains and implications for structural genomics
    H Lee, Z Li, A Silkov, M Fischer, D Petrey - Journal of structural and , 2010 - Springer
     
    12. Crystal structure and computational analyses provide insights into the catalytic mechanism of 2, 4-diacetylphloroglucinol hydrolase PhlG from Pseudomonas
    YX He, L Huang, Y Xue, X Fei, YB Teng - Journal of Biological , 2010 - ASBMB
     
    13. Site-directed mutagenesis and structural modeling of Coq10p indicate the presence of a tunnel for coenzyme Q6 binding
    C Busso, L Bleicher, JR Ferreira-Jnior, MH Barros - FEBS letters, 2010 - Elsevier
     
    14. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    15. Structure of a conserved hypothetical protein, TTHA0849 from Thermus thermophilus HB8, at 2.4 A resolution: a putative member of the StAR-related lipid-transfer (
    M Nakabayashi, N Shibata, H Komori - Section F: Structural , 2005 - scripts.iucr.org
     
    16. Identification of small-molecule inhibitors of the steroidogenic acute regulatory protein (STARD1) by structure-based design
    N Akula, A Midzak, L Lecanu - Bioorganic & medicinal , 2012 - Elsevier
     
    17. 1 H, 13 C, and 15 N backbone resonance assignments of the L124D mutant of StAR-related lipid transfer domain protein 4 (StARD4)
    I Dikiy, TF Ramlall, D Eliezer - Biomolecular NMR Assignments, 2012 - Springer
     
    18. Recombinant protein variants
    J Holm, JN Larsen - EP Patent 2,270,164, 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch