.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jsx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Escherichia coli glucose-inhibited division protein B (GidB) reveals a methyltransferase fold. Proteins 47 563-567 2002
    Site NYSGXRC
    PDB Id 1jsx Target Id NYSGXRC-T35
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8089,P17113 Molecular Weight 23429.91 Da.
    Residues 207 Isoelectric Point 6.06
    Sequence mlnklslllkdagisltdhqknqliayvnmlhkwnkaynltsvrdpnemlvrhildsivvapylqgerf idvgtgpglpgiplsivrpeahftlldslgkrvrflrqvqhelkleniepvqsrveefpseppfdgvis rafaslndmvswchhlpgeqgrfyalkgqmpedeiallpeeyqvesvvklqvpaldgerhlvvikanki
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.2750000
    Matthews' coefficent 2.33 Rfactor 0.2400000
    Waters 127 Solvent Content 47.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jsx
    1. SAM (dependent) I AM: the S-adenosylmethionine-dependent methyltransferase fold
    JL Martin, FM McMillan - Current opinion in structural biology, 2002 - Elsevier
     
    2. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    3. Computing multiple sequence/structure alignments with the T-coffee package
    C Notredame, K Suhre - Curr Protoc Bioinformatics, 2010 - Wiley Online Library
     
    4. Crystal structure of the Escherichia coli glucose_inhibited division protein B (GidB) reveals a methyltransferase fold
    MJ Romanowski, JB Bonanno - : Structure, Function, and , 2002 - Wiley Online Library
     
    5. Structural basis for the methylation of G1405 in 16S rRNA by aminoglycoside resistance methyltransferase Sgm from an antibiotic producer: a diversity of active sites
    N Husain, KL Tkaczuk, SR Tulsidas - Nucleic acids , 2010 - Oxford Univ Press
     
    6. Structural and functional studies of the Thermus thermophilus 16S rRNA methyltransferase RsmG
    ST Gregory, H Demirci, R Belardinelli, T Monshupanee - RNA, 2009 - rnajournal.cshlp.org
     
    7. An intact SAM_dependent methyltransferase fold is encoded by the human endothelin_converting enzyme_2 gene
    W Tempel, H Wu, L Dombrovsky, H Zeng - Proteins: Structure, , 2009 - Wiley Online Library
     
    8. Solution Structure of LCI, A Novel Antimicrobial Peptide from Bacillus subtilis
    W Gong, J Wang, Z Chen, B Xia, G Lu - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch