.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jyh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Escherichia coli SbmC protein that protects cells from the DNA replication inhibitor microcin B17. Proteins 47 403-407 2002
    Site NYSGXRC
    PDB Id 1jyh Target Id NYSGXRC-T473
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8109,P33012 Molecular Weight 18080.63 Da.
    Residues 157 Isoelectric Point 4.61
    Sequence mnyeikqeekrtvagfhlvgpweqtvkkgfeqlmmwvdsknivpkewvavyydnpdetpaeklrcdtvv tvpgyftlpensegvilteitggqyavavarvvgddfakpwyqffnsllqdsayemlpkpcfevylnng aedgywdiemyvavqpkhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2220000
    Matthews' coefficent 2.93 Rfactor 0.1960000
    Waters 177 Solvent Content 58.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jyh
    1. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    2. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    3. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    4. The first structure from the SOUL/HBP family of heme-binding proteins, murine P22HBP
    JS Dias, AL Macedo, GC Ferreira, FC Peterson - Journal of Biological , 2006 - ASBMB
     
    5. Crystal structure of the Escherichia coli SbmC protein that protects cells from the DNA replication inhibitor microcin B17
    MJ Romanowski, SA Gibney - : Structure, Function, and , 2002 - Wiley Online Library
     
    6. The SHS2 module is a common structural theme in functionally diverse protein groups, like Rpb7p, FtsA, GyrI, and MTH1598/TM1083 superfamilies
    V Anantharaman, L Aravind - Proteins: Structure, Function, and , 2004 - Wiley Online Library
     
    7. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    8. Predicted role for the archease protein family based on structural and sequence analysis of TM1083 and MTH1598, two proteins structurally characterized through
    JM Canaves - Proteins: Structure, Function, and Bioinformatics, 2004 - Wiley Online Library
     
    9. A novel haem-binding interface in the 22 kDa haem-binding protein p22HBP
    DA Gell, BJ Westman, D Gorman, CK Liew - Journal of molecular , 2006 - Elsevier
     
    10. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    11. Crystal Structure of an Integron Gene Cassette-Associated Protein from Vibrio cholerae Identifies a Cationic Drug-Binding Module
    CN Deshpande, SJ Harrop, Y Boucher, KA Hassan - PloS one, 2011 - dx.plos.org
     
    12. Topologies of surfaces on molecules and their computation in O (n) time
    DS Kim, Y Cho, J Ryu, CM Kim - Computer-Aided Design, 2010 - Elsevier
     
    13. Beta_decomposition for the volume and area of the union of three_dimensional balls and their offsets
    DS Kim, J Ryu, H Shin, Y Cho - Journal of Computational , 2012 - Wiley Online Library
     
    14. Computational and experimental investigations of forces in protein folding
    DA Schell - 2003 - txspace.di.tamu.edu
     
    15. PTP-PEST couples membrane protrusion and tail retraction via VAV2 and p190RhoGAP.
    SK Sastry, Z Rajfur, BP Liu, JF Cote, ML Tremblay - Interaction, 2005 - projects.itn.pt
     
    16. Fragment Library-Based Representation System for Protein Conformation
    R Kim, CY Choi - Protein and Peptide Letters, 2006 - ingentaconnect.com
     
    17. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch