.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jzt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Yeast Hypothetical Protein YNU0_YEAST. To be Published
    Site NYSGXRC
    PDB Id 1jzt Target Id NYSGXRC-P097
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8074,P40165 Molecular Weight 27519.53 Da.
    Residues 246 Isoelectric Point 8.52
    Sequence mstlkvvssklaaeidkelmgpqigftlqqlmelagfsvaqavcrqfplrgktetekgkhvfviagpgn nggdglvcarhlklfgynpvvfypkrsertefykqlvhqlnffkvpvlsqdegnwleylkpektlcivd aifgfsfkppmrepfkgiveelckvqniipivsvdvptgwdvdkgpisqpsinpavlvsltvpkpcssh irenqtthyvggrfiprdfankfgfepfgyestdqilkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.94 Rfree 0.2370000
    Matthews' coefficent 2.29 Rfactor 0.2000000
    Waters 309 Solvent Content 0.46

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 1jzt
    1. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    2. Are acidic and basic groups in buried proteins predicted to be ionized?
    J Kim, J Mao, MR Gunner - Journal of molecular biology, 2005 - Elsevier
     
    3. Novel conserved domains in proteins with predicted roles in eukaryotic cell-cycle regulation, decapping and RNA stability
    V Anantharaman, L Aravind - BMC genomics, 2004 - biomedcentral.com
     
    4. Novel Sm-like proteins with long C-terminal tails and associated methyltransferases
    M Albrecht, T Lengauer - FEBS letters, 2004 - Elsevier
     
    5. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    6. Crystal structure of human Edc3 and its functional implications
    SHM Ling, CJ Decker, MA Walsh, M She - and cellular biology, 2008 - Am Soc Microbiol
     
    7. Combining fold recognition and exploratory data analysis for searching for glycosyltransferases in the genome of Mycobacterium tuberculosis
    M Wimmerov, SB Engelsen, E Bettler, C Breton - Biochimie, 2003 - Elsevier
     
    8. Biochemical and structural characterization of apolipoprotein AI binding protein, a novel phosphoprotein with a potential role in sperm capacitation
    KN Jha, IA Shumilin, LC Digilio, O Chertihin - Endocrinology, 2008 - Endocrine Soc
     
    9. Static and dynamic characteristics of protein contact networks
    S Khor - Arxiv preprint arXiv:1011.2222, 2010 - arxiv.org
     
    10. Development and application of methodology for rapid NMR data collection and protein structure determination
    DM Parish - 2008 - books.google.com
     
    11. Identification of Unknown Protein Function Using Metabolite Cocktail Screening
    IA Shumilin, M Cymborowski, O Chertihin, KN Jha - Structure, 2012 - Elsevier
     
    12. Complete Prokaryotic Genomes: Reading and Comprehension
    MY Galperin, EV Koonin - Systems Biology: Genomics, 2007 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch