.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k47

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily. Proteins 47 568-571 2002
    Site NYSGXRC
    PDB Id 1k47 Target Id NYSGXRC-T27
    Molecular Characteristics
    Source Streptococcus pneumoniae
    Alias Ids TPS8088,Q9FD52 Molecular Weight 37165.63 Da.
    Residues 336 Isoelectric Point 5.00
    Sequence miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmfdfavdlrpnpdysliqet ialmgdflavrgqnlrpfslkicgkmeregkkfglgssgsvvvlvvkallalynlsvdqnllfkltsav llkrgdngsmgdlacivaedlvlyqsfdrqkaaawleeenlatvlerdwgffisqvkptlecdflvgwt kevavsshmvqqikqninqnflsssketvvslvealeqgkaekvieqvevasklleglstdiytpllrq lkeasqdlqavakssgagggdcgialsfdaqssrntlknrwadlgiellyqerighddks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.42 Rfree 0.2570000
    Matthews' coefficent 3.14 Rfactor 0.2150000
    Waters 779 Solvent Content 60.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1k47
    1. Sites for interaction between Gal80p and Gal1p in Kluyveromyces lactis: structural model of galactokinase based on homology to the GHMP protein family
    RA Menezes, C Amuel, R Engels - Journal of molecular , 2003 - Elsevier
     
    2. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    3. CASP5 assessment of fold recognition target predictions
    LN Kinch, JO Wrabl, S Krishna - Proteins: Structure, , 2003 - Wiley Online Library
     
    4. Crystal structure of 4-(cytidine 5_-diphospho)-2-C-methyl-D-erythritol kinase, an enzyme in the non-mevalonate pathway of isoprenoid synthesis
    T Wada, T Kuzuyama, S Satoh, S Kuramitsu - Journal of Biological , 2003 - ASBMB
     
    5. Crystal structure of the Streptococcus pneumoniae phosphomevalonate kinase, a member of the GHMP kinase superfamily
    MJ Romanowski, JB Bonanno - : Structure, Function, and , 2002 - Wiley Online Library
     
    6. Structural genomics of proteins from conserved biochemical pathways and processes
    SK Burley, JB Bonanno - Current opinion in structural biology, 2002 - Elsevier
     
    7. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators
    JG Luz, CA Hassig, C Pickle, A Godzik - Science's , 2003 - stke.sciencemag.org
     
    8. Molecular functions of conserved aspects of the GHMP kinase family
    JL Andreassi II, TS Leyh - Biochemistry, 2004 - ACS Publications
     
    9. Structure of the ternary complex of phosphomevalonate kinase: the enzyme and its family
    JL Andreassi, MW Vetting, PW Bilder, SL Roderick - Biochemistry, 2009 - ACS Publications
     
    10. Structure-based drug design targeting biosynthesis of isoprenoids: a crystallographic state of the art of the involved enzymes
    J Ruyck, J Wouters - Current Protein and Peptide Science, 2008 - ingentaconnect.com
     
    11. Structure and properties of camptothecin derivatives, their protonated forms, and model interaction with the topoisomerase IDNA complex
    B Ivanova, M Spiteller - Biopolymers, 2011 - Wiley Online Library
     
    12. GHMP kinases-structures, mechanisms and potential for therapeutically relevant inhibition
    DJ Timson - Current Enzyme Inhibition, 2007 - ingentaconnect.com
     
    13. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    14. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    15. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    16. Crystal Structure of Diedel, a Marker of the Immune Response of Drosophila melanogaster
    F Coste, C Kemp, V Bobezeau, C Hetru - PloS one, 2012 - dx.plos.org
     
    17. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    18. Analysis of the GAL3 protein, a key component of the GAL gene transcription switch in Saccharomyces cerevisiae
    CQ Diep - 2006 - books.google.com
     
    19. Estudos estruturais da enzima fosforribosilpirofosfato sintase de cana-de-acar
    HB Napolitano - 2004 - ifsc.usp.br
     
    20. Structural studies of terpenoid biosynthesis and bacterial cell division
    D Yang - 2006 - repository.tamu.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch