.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k4z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the actin binding domain of the cyclase-associated protein. Biochemistry 43 10628-10641 2004
    Site NYSGXRC
    PDB Id 1k4z Target Id NYSGXRC-T140
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8106,134897 Molecular Weight 57518.33 Da.
    Residues 526 Isoelectric Point 5.48
    Sequence mpdskytmqgynlvkllkrleeatarledvtiyqegyiqnkleasknnkpsdsgadanttnepsaenap eveqdpkcitafqsyigenidplvelsgkidtvvldalqllkggfqsqltflraavrsrkpdyssqtfa dslrpineniiklgqlkesnrqskyfaylsalsegaplfswvavdtpvsmvtdfkdaaqfwtnrilkey resdpnavewvkkflasfdnlkayikeyhttgvswkkdgmdfadamaqstkntgatsspspasataapa ppppppappasvfeisndtpatssdankggigavfaelnqgenitkglkkvdksqqthknpelrqsstv sstgsksgppprpkkpstlktkrpprkelvgnkwfienyeneteslvidankdesifigkcsqvlvqik gkvnaislsetescsvvldssisgmdviksnkfgiqvnhslpqisidksdggniylskeslnteiytsc stainvnlpigedddyvefpipeqmkhsfadgkfksavfehag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.242
    Matthews' coefficent 2.83 Rfactor 0.207
    Waters 160 Solvent Content 56.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1k4z
    1. Structural genomics: a pipeline for providing structures for the biologist
    MR Chance, AR Bresnick, SK Burley, JS Jiang - Protein , 2002 - Wiley Online Library
     
    2. A high-affinity interaction with ADP-actin monomers underlies the mechanism and in vivo function of Srv2/cyclase-associated protein
    PK Mattila, O Quintero-Monzon, J Kugler - Molecular biology of , 2004 - Am Soc Cell Biol
     
    3. Structure of the N-terminal domain of the adenylyl cyclase-associated protein (CAP) from Dictyostelium discoideum
    D Ksiazek, H Brandstetter, L Israel, GP Bourenkov - Structure, 2003 - Elsevier
     
    4. Crystal structure of the actin binding domain of the cyclase-associated protein
    T Dodatko, AA Fedorov, M Grynberg, Y Patskovsky - Biochemistry, 2004 - ACS Publications
     
    5. Sequence and structure analysis of parallel _ helices: implication for constructing amyloid structural models
    HHG Tsai, K Gunasekaran, R Nussinov - Structure, 2006 - Elsevier
     
    6. Fold recognition and accurate sequencestructure alignment of sequences directing __sheet proteins
    AV McDonnell, M Menke, N Palmer - Proteins: Structure, , 2006 - Wiley Online Library
     
    7. Conformational and sequence signatures in _ helix proteins
    P Iengar, NV Joshi, P Balaram - Structure, 2006 - Elsevier
     
    8. NMR structural characterization of the N-terminal domain of the adenylyl cyclase-associated protein (CAP) from Dictyostelium discoideum
    C Mavoungou, L Israel, T Rehm, D Ksiazek - Journal of Biomolecular , 2004 - Springer
     
    9. Structural evidence for variable oligomerization of the N_terminal domain of cyclase_associated protein (CAP)
    AM Yusof, NJ Hu, A Wlodawer - : Structure, Function, and , 2005 - Wiley Online Library
     
    10. Mechanism of Oligomerisation of Cyclase-associated Protein from Dictyostelium discoideum in Solution
    AM Yusof, E Jaenicke, JS Pedersen, AA Noegel - Journal of molecular , 2006 - Elsevier
     
    11. Structural studies of cytoskeleton proteins, proteases and IGF-binding proteins
    GM Popowicz - 2006 - deposit.ddb.de
     
    12. Prediction of parallel in-register amyloidogenic beta-structures In highly beta-rich protein sequences by pairwise propensity analysis
    B Berger, SL Lindquist, AW Bryan - 2009 - dspace.mit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch