.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kcx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural bases for CRMP function in plexin-dependent semaphorin3A signaling. Embo J. 23 9-22 2004
    Site NYSGXRC
    PDB Id 1kcx Target Id NYSGXRC-T45
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS8090,2342488 Molecular Weight 62103.36 Da.
    Residues 572 Isoelectric Point 7.00
    Sequence mshqgkksiphitsdrllirggriinddqsfyadvyledglikqigenlivpggvktieangrmvipgg idvntylqkpsqgmtsaddffqgtkaalaggttmiidhvvpepgsslltsfekwheaadtksccdyslh vditswydgvreelevlvqdkgvnsfqvymaykdlyqmsdsqlyeaftflkglgavilvhaengdliaq eqkrilemgitgpeghalsrpeeleaeavfraiaiagrincpvyitkvmsksaadiialarkkgplvfg epiaaslgtdgthywsknwakaaafvtspplspdpttpdyltsllacgdlqvtgsghcpystaqkavgk dnftlipegvngieermtvvwdkavatgkmdenqfvavtstnaakifnlyprkgriavgsdadvviwdp dkmktitakshkstveynifegmechgsplvvisqgkivfedgnisvskgmgrfiprkpfpkhlyqrvr irskvsglhsvsrgmydgpvyevpatpkhaapapsaksspskhqpppirnlhqsnfslsgaqiddnnpr rtghrivappggrsnitslg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.12 Rfree 0.233
    Matthews' coefficent 3.27 Rfactor 0.204
    Waters 804 Solvent Content 62.39

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kcx
    1. Structural bases for CRMP function in plexin-dependent semaphorin3A signaling
    RC Deo, EF Schmidt, A Elhabazi, H Togashi - The EMBO , 2003 - nature.com
     
    2. Leveraging enzyme structure-function relationships for functional inference and experimental design: the structure-function linkage database
    SCH Pegg, SD Brown, S Ojha, J Seffernick - Biochemistry, 2006 - ACS Publications
     
    3. The structure of human collapsin response mediator protein 2, a regulator of axonal growth
    P Stenmark, D Ogg, S Flodin, A Flores - Journal of , 2007 - Wiley Online Library
     
    4. Protein docking using surface matching and supervised machine learning
    AJ Bordner, AA Gorin - Proteins: Structure, Function, and , 2007 - Wiley Online Library
     
    5. Crystallization and preliminary crystallographic studies of the recombinant dihydropyrimidinase from Sinorhizobium meliloti CECT4114
    S Martnez-Rodrguez - Section F: Structural , 2006 - scripts.iucr.org
     
    6. Clinical, biochemical and genetic findings in two siblings with a dihydropyrimidinase deficiency
    ABP van Kuilenburg, J Meijer, D Dobritzsch - Molecular genetics and , 2007 - Elsevier
     
    7. Structure of dihydropyrimidinase from Sinorhizobium meliloti CECT4114: New features in an amidohydrolase family member
    S Martnez-Rodrguez, AI Martnez-Gmez - Journal of structural , 2010 - Elsevier
     
    8. Dihydropyrimidinase deficiency: Phenotype, genotype and structural consequences in 17 patients
    ABP van Kuilenburg, D Dobritzsch, J Meijer - et Biophysica Acta (BBA , 2010 - Elsevier
     
    9. Factors influencing protein tyrosine nitrationstructure-based predictive models
    AS Bayden, VA Yakovlev, PR Graves - Free Radical Biology , 2011 - Elsevier
     
    10. Identification of family-specific residue packing motifs and their use for structure-based protein function prediction: II. Case studies and applications
    D Bandyopadhyay, J Huan, J Prins, J Snoeyink - Journal of computer- , 2009 - Springer
     
    11. Purification, crystallization and X-ray diffraction analysis of dihydropyrimidinase from Dictyostelium discoideum
    B Lohkamp, B Andersen, J Piskur - Section F: Structural , 2005 - scripts.iucr.org
     
    12. Feature amplified voting algorithm for functional analysis of protein superfamily
    CL Hung, C Lee, CY Lin, CH Chang, YC Chung - BMC , 2010 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch