.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kmj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Analysis of the E. coli NifS CsdB protein at 2.0A reveals the structural basis for perselenide and persulfide intermediate formation. J.Mol.Biol. 315 1199-1208 2002
    Site NYSGXRC
    PDB Id 1kmj Target Id NYSGXRC-T129
    Related PDB Ids 1jf9 1kmk 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8096,P77444 Molecular Weight 44431.41 Da.
    Residues 406 Isoelectric Point 5.89
    Sequence mifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtlsaqatekm envrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqmehhanivpwqmlcarvg aelrviplnpdgtlqletlptlfdektrllaithvsnvlgtenplaemitlahqhgakvlvdgaqavmh hpvdvqaldcdfyvfsghklygptgigilyvkeallqemppwegggsmiatvslsegttwtkapwrfea gtpntggiiglgaaleyvsalglnniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhay dvgsfldnygiavrtghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.208
    Matthews' coefficent Rfactor 0.178
    Waters 663 Solvent Content

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1kmj
    1. Crystal structure of IscS, a cysteine desulfurase from Escherichia coli
    JR Cupp-Vickery, H Urbina, LE Vickery - Journal of molecular biology, 2003 - Elsevier
     
    2. Analysis of the E. coli NifS CsdB protein at 2.0 reveals the structural basis for perselenide and persulfide intermediate formation1
    CD Lima - Journal of molecular biology, 2002 - Elsevier
     
    3. Structural insights into the second step of RNA-dependent cysteine biosynthesis in archaea: crystal structure of Sep-tRNA: Cys-tRNA synthase from Archaeoglobus
    R Fukunaga, S Yokoyama - Journal of molecular biology, 2007 - Elsevier
     
    4. A new structure_based classification of sulfide: quinone oxidoreductases
    M Marcia, U Ermler, G Peng - : Structure, Function, and , 2010 - Wiley Online Library
     
    5. Crystal structure and substrate specificity of the thermophilic serine: pyruvate aminotransferase from Sulfolobus solfataricus
    C Sayer, M Bommer, M Isupov, J Ward - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch