.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kmk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Analysis of the E. coli NifS CsdB Protein at 2.0A Reveals the Structural Basis for Perselenide and Persulfide Intermediate Formation. J.Mol.Biol. 315 1199-1208 2002
    Site NYSGXRC
    PDB Id 1kmk Target Id NYSGXRC-T129
    Related PDB Ids 1kmj 1jf9 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8097,P77444 Molecular Weight 44431.41 Da.
    Residues 406 Isoelectric Point 5.89
    Sequence mifsvdkvradfpvlsrevnglplayldsaasaqkpsqvidaeaefyrhgyaavhrgihtlsaqatekm envrkraslfinarsaeelvfvrgtteginlvanswgnsnvragdniiisqmehhanivpwqmlcarvg aelrviplnpdgtlqletlptlfdektrllaithvsnvlgtenplaemitlahqhgakvlvdgaqavmh hpvdvqaldcdfyvfsghklygptgigilyvkeallqemppwegggsmiatvslsegttwtkapwrfea gtpntggiiglgaaleyvsalglnniaeyeqnlmhyalsqlesvpdltlygpqnrlgviafnlgkhhay dvgsfldnygiavrtghhcamplmayynvpamcraslamyntheevdrlvtglqrihrllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.239
    Matthews' coefficent Rfactor 0.196
    Waters 485 Solvent Content

    Ligand Information
    Ligands CSE-PLP (SELENOCYSTEINE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1kmk
    1. Structural insights into the second step of RNA-dependent cysteine biosynthesis in archaea: crystal structure of Sep-tRNA: Cys-tRNA synthase from Archaeoglobus
    R Fukunaga, S Yokoyama - Journal of molecular biology, 2007 - Elsevier
     
    2. Analysis of the E. coli NifS CsdB protein at 2.0 reveals the structural basis for perselenide and persulfide intermediate formation1
    CD Lima - Journal of molecular biology, 2002 - Elsevier
     
    3. Predictive reconstruction of the mitochondrial iron_sulfur cluster assembly metabolism. II. Role of glutaredoxin Grx5
    R Alves, E Herrero, A Sorribas - Proteins: Structure, Function, , 2004 - Wiley Online Library
     
    4. Structure of selenophosphate synthetase essential for selenium incorporation into proteins and RNAs
    Y Itoh, S Sekine, E Matsumoto, R Akasaka - Journal of molecular , 2009 - Elsevier
     
    5. Crystal structures of catalytic intermediates of human selenophosphate synthetase 1
    KT Wang, J Wang, LF Li, XD Su - Journal of molecular biology, 2009 - Elsevier
     
    6. Biochemical discrimination between selenium and sulfur 1: A single residue provides selenium specificity to human selenocysteine lyase
    R Collins, AL Johansson, T Karlberg, N Markova - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch