.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ku9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray structure of an M. jannaschii DNA-binding protein: implications for antibiotic resistance in S. aureus. Proteins 50 170-173 2002
    Site NYSGXRC
    PDB Id 1ku9 Target Id NYSGXRC-T136
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8103,Q58958 Molecular Weight 17607.78 Da.
    Residues 152 Isoelectric Point 8.44
    Sequence miimeeakkliielfselakihglnksvgavyailylsdkpltisdimeelkiskgnvsmslkkleelg fvrkvwikgerknyyeavdgfssikdiakrkhdliaktyedlkkleekcneeekefikqkikgiermkk isekilealndldn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.28
    Matthews' coefficent 2.74 Rfactor 0.241
    Waters 86 Solvent Content 55.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ku9
    1. A novel archaeal regulatory protein, Sta1, activates transcription from viral promoters
    A Kessler, G Sezonov, JI Guijarro - Nucleic acids , 2006 - Oxford Univ Press
     
    2. The crystal structure of the rare-cutting restriction enzyme SdaI reveals unexpected domain architecture
    G Tamulaitiene, A Jakubauskas, C Urbanke, R Huber - Structure, 2006 - Elsevier
     
    3. Staphylococcal methicillin resistance: fine focus on folds and functions
    G Mallorqu_Fernndez, A Marrero - FEMS microbiology , 2004 - Wiley Online Library
     
    4. The evolutionary history of archaeal MCM helicases: a case study of vertical evolution combined with hitchhiking of mobile genetic elements
    M Krupovi_, S Gribaldo, DH Bamford - Molecular biology and , 2010 - SMBE
     
    5. Detecting DNA-binding helixturnhelix structural motifs using sequence and structure information
    M Pellegrini-Calace, JM Thornton - Nucleic acids research, 2005 - Oxford Univ Press
     
    6. Solution Structure of Escherichia coli PapI, a Key Regulator of the Pap Pili Phase Variation
    T Kawamura, LUK Le, H Zhou, FW Dahlquist - Journal of molecular biology, 2007 - Elsevier
     
    7. AlignHUSH: Alignment of HMMs using structure and hydrophobicity information
    O Krishnadev, N Srinivasan - BMC bioinformatics, 2011 - biomedcentral.com
     
    8. Genetic control of osmoadaptive glycine betaine synthesis in Bacillus subtilis through the choline-sensing and glycine betaine-responsive GbsR repressor
    G Nau-Wagner, D Opper, A Rolbetzki - Journal of , 2012 - Am Soc Microbiol
     
    9. A structure-based method for identifying DNA-binding proteins and their sites of DNA-interaction
    WA McLaughlin, DW Kulp, J de la Cruz, XJ Lu - Journal of structural and , 2005 - Springer
     
    10. Solution NMR structures reveal unique homodimer formation by a winged helix-turn-helix motif and provide first structures for protein domain family PF10771
    A Eletsky, D Petrey, QC Zhang, HW Lee - Journal of Structural and , 2012 - Springer
     
    11. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch