.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lnz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical analysis of the Obg GTP binding protein. Structure 10 1581-1592 2002
    Site NYSGXRC
    PDB Id 1lnz Target Id NYSGXRC-T131
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8099,P20964 Molecular Weight 47686.50 Da.
    Residues 428 Isoelectric Point 5.05
    Sequence mfvdqvkvyvkggdggngmvafrrekyvpkggpaggdggkggdvvfevdeglrtlmdfrykkhfkairg ehgmsknqhgrnaddmvikvppgtvvtdddtkqviadltehgqraviarggrggrgnsrfatpanpapq lsengepgkeryivlelkvladvglvgfpsvgkstllsvvssakpkiadyhfttlvpnlgmvetddgrs fvmadlpgliegahqgvglghqflrhiertrvivhvidmsglegrdpyddyltinqelseynlrlterp qiivankmdmpeaaenleafkekltddypvfpisavtreglrellfevanqlentpefplydeeeltqn rvmytmeneevpfnitrdpdgvfvlsgdslerlfkmtdfsrdesvkrfarqmrgmgvdealrergakdg diirllefefefid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.60 Rfree 0.2930000
    Matthews' coefficent 2.55 Rfactor 0.2030000
    Waters 484 Solvent Content 51.68

    Ligand Information
    Ligands G4P (GUANOSINE-5',3'-TETRAPHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 7

    Jmol

     
    Google Scholar output for 1lnz
    1. Structure-function relationships of the G domain, a canonical switch motif
    A Wittinghofer, IR Vetter - Annual review of biochemistry, 2011 - annualreviews.org
     
    2. Molecular modeling study for interaction between Bacillus subtilis Obg and nucleotides
    Y Lee, WY Bang, S Kim, P Lazar, CW Kim, JD Bahk - PloS one, 2010 - dx.plos.org
     
    3. Binding Mode Analysis of Bacillus subtilis Obg with Ribosomal Protein L13 through Computational Docking Study
    S Choi, E Womans - IBC, 2009 - bio.gnu.ac.kr
     
    4. The Escherichia coli GTPase ObgE modulates hydroxyl radical levels in response to DNA replication fork arrest
    CI Kint, N Verstraeten, I Wens, VR Liebens - FEBS , 2012 - Wiley Online Library
     
    5. Direct binding targets of the stringent response alarmone (p) ppGpp
    U Kanjee, K Ogata, WA Houry - Molecular Microbiology, 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch