.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lw4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Structures of Threonine Aldolase Complexes: Structural Basis of Substrate Recognition. Biochemistry 41 11711-11720 2002
    Site NYSGXRC
    PDB Id 1lw4 Target Id NYSGXRC-P044a
    Related PDB Ids 1lw5 1jg8 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8066,Q9X266 Molecular Weight 37572.08 Da.
    Residues 343 Isoelectric Point 6.23
    Sequence midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtmgnqvsimah tqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkairprnihfprtsliaienth nrsggrvvplenikeictiakehginvhidgarifnasiasgvpvkeyagyadsvmfclskglcapvgs vvvgdrdfierarkarkmlgggmrqagvlaaagiialtkmvdrlkedhenarflalklkeigysvnped vktnmvilrtdnlkvnahgfiealrnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.90 Rfree 0.2057
    Matthews' coefficent 2.33 Rfactor 0.1829
    Waters 1029 Solvent Content 47.11

    Ligand Information
    Ligands TLP-PLP (3-HYDROXY-2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-) x 1;TLP (PYRIDOXAL-5'-PHOSPHATE) x 2
    Metals CL (CHLORIDE) x 6;CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 1lw4
    1. X-ray structures of threonine aldolase complexes: structural basis of substrate recognition
    CL Kielkopf, SK Burley - Biochemistry, 2002 - ACS Publications
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. A novel genetic selection system for PLP-dependent threonine aldolases
    L Giger, MD Toscano, M Bouzon, P Marlire, D Hilvert - Tetrahedron, 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch