.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lx7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Escherichia coli uridine phosphorylase at 2.0 A. Acta Crystallogr.,Sect.D 59 73-76 2003
    Site NYSGXRC
    PDB Id 1lx7 Target Id NYSGXRC-T24
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8087,P12758 Molecular Weight 27026.43 Da.
    Residues 252 Isoelectric Point 5.81
    Sequence sksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvivcstgig gpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhfaplefpavadfectta lveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgsmeewqamgvmnyemesatlltmcas qglragmvagvivnrtqqeipnaetmkqteshavkivveaarrll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.215
    Matthews' coefficent 1.93 Rfactor 0.182
    Waters 361 Solvent Content 36.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1lx7
    1. Crystal Structures of Escherichia coli Uridine Phosphorylase in Two Native and Three Complexed Forms Reveal Basis of Substrate Specificity, Induced
    TT Caradoc-Davies, SM Cutfield, IL Lamont - Journal of molecular , 2004 - Elsevier
     
    2. Structure of Escherichia coli uridine phosphorylase at 2.0 A
    FT Burling, R Kniewel, JA Buglino - Section D: Biological , 2002 - scripts.iucr.org
     
    3. Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches
    BV Strokopytov, A Fedorov, NM Mahoney - Section D: Biological , 2005 - scripts.iucr.org
     
    4. Structural basis for inhibition of Escherichia coli uridine phosphorylase by 5-substituted acyclouridines
    W Bu, EC Settembre, MH el Kouni - Section D: Biological , 2005 - scripts.iucr.org
     
    5. Structures of Plasmodium falciparum purine nucleoside phosphorylase complexed with sulfate and its natural substrate inosine
    C Schnick, MA Robien, AM Brzozowski - Section D: Biological , 2005 - scripts.iucr.org
     
    6. Correlation between the structural stability and aggregation propensity of proteins
    S Idicula-Thomas, PV Balaji - In silico biology, 2007 - IOS Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch