.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m0t

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase. Structure 10 1669-1676 2002
    Site NYSGXRC
    PDB Id 1m0t Target Id NYSGXRC-P102
    Related PDB Ids 1m0w 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8076,Q08220 Molecular Weight 55812.24 Da.
    Residues 491 Isoelectric Point 5.50
    Sequence mahyppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiqpvfn elyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlgifrsdylidkkkg teqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqnmvisdsgyllskalakavesyk sqqsssttsdpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndklfiddktgklfirdte qeiavvyyrtgytttdytsekdwearlfleksfaikapdlltqlsgskkiqqlltdegvlgkyisdaek kssllktfvkiyplddtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayil meliepelnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfg cldsiily
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.237
    Matthews' coefficent 2.31 Rfactor 0.216
    Waters 498 Solvent Content 46.72

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1m0t
    1. Prediction of interaction sites from apo 3D structures when the holo conformation is different
    LF Murga, MJ Ondrechen - : Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch