.
The Open Protein Structure Annotation Network
PDB Keyword
.

1m0w

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Large Conformational Changes in the Catalytic Cycle of Glutathione Synthase. Structure 10 1669-1676 2002
    Site NYSGXRC
    PDB Id 1m0w Target Id NYSGXRC-P102
    Related PDB Ids 1m0t 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8077,Q08220 Molecular Weight 55812.24 Da.
    Residues 491 Isoelectric Point 5.50
    Sequence mahyppskdqlneliqevnqwaitnglsmyppkfeenpsnasvspvtiyptpiprkcfdeavqiqpvfn elyaritqdmaqpdsylhkttealalsdseftgklwslylatlksaqykkqnfrlgifrsdylidkkkg teqikqvefntvsvsfaglsekvdrlhsylnrankydpkgpiyndqnmvisdsgyllskalakavesyk sqqsssttsdpivafivqrnernvfdqkvlelnllekfgtksvrltfddvndklfiddktgklfirdte qeiavvyyrtgytttdytsekdwearlfleksfaikapdlltqlsgskkiqqlltdegvlgkyisdaek kssllktfvkiyplddtklgregkrlalsepskyvlkpqregggnnvykenipnflkgieerhwdayil meliepelnenniilrdnksynepiiselgiygcvlfndeqvlsnefsgsllrskfntsneggvaagfg cldsiily
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.196
    Matthews' coefficent 2.34 Rfactor 0.172
    Waters 747 Solvent Content 47.38

    Ligand Information
    Ligands SO4 (SULFATE) x 7;ANP (PHOSPHOAMINOPHOSPHONIC) x 2;3GC (GAMMA-GLUTAMYLCYSTEINE) x 2
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1m0w
    1. Molecular determinants for ATP-binding in proteins: a data mining and quantum chemical analysis
    L Mao, Y Wang, Y Liu, X Hu - Journal of molecular biology, 2004 - Elsevier
     
    2. Geometry of nonbonded interactions involving planar groups in proteins
    P Chakrabarti, R Bhattacharyya - Progress in biophysics and molecular , 2007 - Elsevier
     
    3. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    4. Interaction interfaces of protein domains are not topologically equivalent across families within superfamilies: Implications for metabolic and signaling pathways
    N Rekha, SM Machado, C Narayanan - Proteins: Structure, , 2005 - Wiley Online Library
     
    5. Function of Conserved Residues of Human Glutathione Synthetase
    A Dinescu, TR Cundari, VS Bhansali, JL Luo - Journal of Biological , 2004 - ASBMB
     
    6. Molecular dynamics simulations of biotin carboxylase
    SON Lill, J Gao, GL Waldrop - The Journal of Physical Chemistry , 2008 - ACS Publications
     
    7. Prediction of interaction sites from apo 3D structures when the holo conformation is different
    LF Murga, MJ Ondrechen - : Structure, Function, and , 2008 - Wiley Online Library
     
    8. Structure of Trypanosoma brucei glutathione synthetase: Domain and loop alterations in the catalytic cycle of a highly conserved enzyme
    PK Fyfe, MS Alphey, WN Hunter - Molecular and biochemical parasitology, 2010 - Elsevier
     
    9. The utility of molecular dynamics simulations for understanding site_directed mutagenesis of glycine residues in biotin carboxylase
    T Bordelon, SO Nilsson Lill - : Structure, Function, and , 2009 - Wiley Online Library
     
    10. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    11. Overcoming sequence misalignments with weighted structural superposition
    NA Khazanov, KL Damm_Ganamet - Proteins: Structure, , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch