.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n10

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Crystal Structure of Phl p 1, a Major Timothy Grass Pollen Allergen. To be Published
    Site NYSGXRC
    PDB Id 1n10 Target Id NYSGXRC-T1467
    Molecular Characteristics
    Source Phleum pratense (common timothy)
    Alias Ids TPS8169,P43213 Molecular Weight 28455.75 Da.
    Residues 263 Isoelectric Point 6.14
    Sequence massssvllvvvlfavflgsaygipkvppgpnitatygdkwldakstwygkptgagpkdnggacgykdv dkppfsgmtgcgntpifksgrgcgscfeikctkpeacsgepvvvhitddneepiapyhfdlsghafgam akkgdeqklrsagelelqfrrvkckypegtkvtfhvekgsnpnylallvkyvngdgdvvavdikekgkd kwielkeswgaiwridtpdkltgpftvrytteggtkteaedvipegwkadtsyesk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.267
    Matthews' coefficent 2.58 Rfactor 0.239
    Waters Solvent Content 50.56

    Ligand Information
    Ligands NAG (N-ACETYL-D-GLUCOSAMINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1n10
    1. Crystal structure and activities of EXPB1 (Zea m 1), a _-expansin and group-1 pollen allergen from maize
    NH Yennawar, LC Li, DM Dudzinski - Proceedings of the , 2006 - National Acad Sciences
     
    2. Spatial clustering of the IgE epitopes on the major timothy grass pollen allergen Phl p 1: importance for allergenic activity
    S Flicker, P Steinberger, T Ball, MT Krauth - Journal of allergy and , 2006 - Elsevier
     
    3. A plant natriuretic peptide-like gene in the bacterial pathogen Xanthomonas axonopodis may induce hyper-hydration in the plant host: a hypothesis of
    V Nembaware, C Seoighe, M Sayed - BMC evolutionary , 2004 - biomedcentral.com
     
    4. Crystal structure and activity of Bacillus subtilis YoaJ (EXLX1), a bacterial expansin that promotes root colonization
    F Kerff, A Amoroso, R Herman - Proceedings of the , 2008 - National Acad Sciences
     
    5. Characteristic motifs for families of allergenic proteins
    O Ivanciuc, T Garcia, M Torres, CH Schein - Molecular immunology, 2009 - Elsevier
     
    6. A recombinant plant natriuretic peptide causes rapid and spatially differentiated K+, Na+ and H+ flux changes in Arabidopsis thaliana roots
    N Ludidi, M Morse, M Sayed, T Wherrett - Plant and cell , 2004 - Jpn Soc Plant Physiol
     
    7. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     
    8. Specific immunotherapy for common grass pollen allergies: pertinence of a five grass pollen vaccine
    P Moingeon, M Hrabina, KC Bergmann - archives of allergy , 2008 - content.karger.com
     
    9. Reducing allergenicity by altering allergen fold: a mosaic protein of Phl p 1 for allergy vaccination
    T Ball, B Linhart, K Sonneck, K Blatt, H Herrmann - Allergy, 2009 - Wiley Online Library
     
    10. Plant natriuretic peptide active site determination and effects on cGMP and cell volume regulation
    YH Wang, C Gehring, DM Cahill, HR Irving - Functional plant biology, 2007 - CSIRO
     
    11. Increased activity and efficiency of expansin-like proteins
    DJ Cosgrove - US Patent App. 11/893,509, 2007 - Google Patents
     
    12. Geometric and statistical properties of the mean-field hydrophobic-polar model, the large-small model, and real protein sequences
    CT Shih, ZY Su, JF Gwan, BL Hao, CH Hsieh, JL Lo - Physical Review E, 2002 - APS
     
    13. Extensive IgE cross-reactivity towards the Pooideae grasses substantiated for a large number of grass-pollen-sensitized subjects
    N Johansen, RW Weber, H Ipsen - archives of allergy , 2009 - content.karger.com
     
    14. Identification of putative expansin-like genes from the pine wood nematode, Bursaphelenchus xylophilus, and evolution of the expansin gene family within the
    T Kikuchi, H Li, N Karim, MW Kennedy, M Moens - , 2009 - ingentaconnect.com
     
    15. Allergen cleavage by effector cell-derived proteases regulates allergic inflammation
    I Rauter, MT Krauth, S Flicker, A Gieras - The FASEB journal, 2006 - FASEB
     
    16. Molecular variability of group 1 and 5 grass pollen allergens between Pooideae species: implications for immunotherapy
    H Chabre, B Gouyon, A Huet - Clinical & , 2010 - Wiley Online Library
     
    17. Structural characterziation of pollen allergens
    P Verdino - Clinical reviews in allergy and immunology, 2006 - Springer
     
    18. Three-dimensional structure determines the pattern of CD4+ T-cell epitope dominance in influenza virus hemagglutinin
    SJ Landry - Journal of virology, 2008 - Am Soc Microbiol
     
    19. Allergen structures and biologic functions: the cutting edge of allergy research
    A Poms - Current allergy and asthma reports, 2008 - Springer
     
    20. Loosenin, a novel protein with cellulose-disrupting activity from Bjerkandera adusta
    RE Quiroz-Castaeda - Microbial Cell , 2011 - microbialcellfactories.com
     
    21. Molecular biology of allergens: structure and immune recognition
    MD Chapman, A Poms, RC Aalberse - Allergy Frontiers: Epigenetics, , 2009 - Springer
     
    22. Anti-idiotypic Fab Fragments Image a Conserved N-terminal Epitope Patch of Grass Pollen Allergen Phl p 1
    A Lukschal, J Fuhrmann, J Sobanov - The open allergy , 2011 - ncbi.nlm.nih.gov
     
    23. Phleum pratense alone is representative for pooideae grass pollen species due to high immunochemical similarity between homologous grass pollen allergens
    JN Larsen, C Hejl, H Ipsen, PA Wurtzen - World Allergy , 2007 - journals.lww.com
     
    24. HYPALLERGENIC MOSAIC ANTIGENS AND METHODS OF MAKING SAME
    R Campana, R Valenta, S Vrtala - US Patent , 2012 - freepatentsonline.com
     
    25. INAUGURAL ARTICLE by a Recently Elected Academy Member: Crystal structure and activities of EXPB1 (Zea m 1), a _-expansin and group-1 pollen
    NH Yennawar, LC Li, DM Dudzinski - Proceedings of the , 2006 - ncbi.nlm.nih.gov
     
    26. Structure, Allergenicity, and Cross-Reactivity of Plant Allergens
    C Radauer, H Breiteneder - Clinical Applications of Immunomics, 2009 - Springer
     
    27. Towards the rational design of mechanical proteins
    T Garcia - 2009 - repositories.tdl.org
     
    28. Antibody compositions specific for lgE, lgG4 and lgA epitopes as tools for the design of hypoallergenic molecules for specific immunotherapy
    I Braren, D Grunwald, D Spillner - EP Patent 2,022,507, 2009 - freepatentsonline.com
     
    29. The structure of the elicitor cerato-platanin, first member of the CP fungal protein family, reveals a double __-barrel fold and carbohydrate binding
    AL Oliveira, M Gallo, L Pazzagli, CE Benedetti - Journal of Biological , 2011 - ASBMB
     
    30. Molecular characterisation of major allergens from mite (Lep d 2) and cat (Fel d 1)
    L Kaiser - 2004 - diss.kib.ki.se
     
    31. Binding polypeptides for B lymphocyte stimulator protein (BLyS)
    JP Beltzer, DM Potter, TJ Fleming - EP Patent , 2010 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch