.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ne8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YdcE protein from Bacillus subtilis. PROTEINS: STRUCT.,FUNCT.,GENET. 53 320-322 2003
    Site NYSGXRC
    PDB Id 1ne8 Target Id NYSGXRC-T503
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8110,P96622 Molecular Weight 12977.27 Da.
    Residues 116 Isoelectric Point 5.07
    Sequence mivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthveidakrygf erdsvilleqirtidkqrltdkithlddemmdkvdealqislalidf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.2097
    Matthews' coefficent 2.45 Rfactor 0.1585
    Waters 100 Solvent Content 49.77

    Ligand Information
    Ligands 1PG (2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHOXY)-) x 2;ACY (ACETIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 1ne8
    1. Shutdown decay of mRNA
    C Condon - Molecular microbiology, 2006 - Wiley Online Library
     
    2. The Bacillus subtilis ydcDE operon encodes an endoribonuclease of the MazF/PemK family and its inhibitor
    O Pellegrini, N Mathy, A Gogos, L Shapiro - Molecular , 2005 - Wiley Online Library
     
    3. Mutagenesis-based definitions and probes of residue burial in proteins
    K Bajaj, P Chakrabarti - Proceedings of the , 2005 - National Acad Sciences
     
    4. Toxin-antitoxin systems in bacteria and archaea
    Y Yamaguchi, JH Park, M Inouye - Annual review of genetics, 2011 - annualreviews.org
     
    5. Crystal structure of YdcE protein from Bacillus subtilis
    A Gogos, H Mu, F Bahna, CA Gomez - Proteins: Structure, , 2003 - Wiley Online Library
     
    6. Modeling of the structure and interactions of the B. anthracis antitoxin, MoxX: deletion mutant studies highlight its modular structure and repressor function
    N Chopra, S Agarwal, S Verma, S Bhatnagar - Journal of Computer- , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch