The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the S. pombe YchF GTP-binding protein. To be Published
    Site NYSGXRC
    PDB Id 1ni3 Target Id NYSGXRC-T9
    Molecular Characteristics
    Source Schizosaccharomyces pombe
    Alias Ids TPS8083,O13998 Molecular Weight 44330.68 Da.
    Residues 392 Isoelectric Point 7.60
    Sequence mppkkqqevvkvqwgrpgnnlktgivgmpnvgkstffraitksvlgnpanypyatidpeeakvavpder fdwlceaykpksrvpafltvfdiagltkgastgvglgnaflshvravdaiyqvvrafddaeiihvegdv dpirdlsiivdellikdaefvekhleglrkitsrgantlemkakkeeqaiiekvyqyltetkqpirkgd wsnreveiinslylltakpviylvnmserdflrqknkylpkikkwidenspgdtlipmsvafeerltnf teeeaieeckklntksmlpkiivtgynalnlinyftcgedevrswtirkgtkapqaagvihtdfekafv vgeimhyqdlfdyktenacraagkyltkgkeyvmesgdiahwkagkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.265
    Matthews' coefficent 3.62 Rfactor 0.213
    Waters 186 Solvent Content 66.03

    Ligand Information
    Ligands SO4 (SULFATE) x 1


    Google Scholar output for 1ni3
    1. 'Conserved hypothetical'proteins: prioritization of targets for experimental study
    MY Galperin, EV Koonin - Nucleic acids research, 2004 - Oxford Univ Press

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch