.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ni5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the MesJ PP-ATPase from Escherichia coli. To be Published
    Site NYSGXRC
    PDB Id 1ni5 Target Id NYSGXRC-T132
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8100,P52097 Molecular Weight 48201.60 Da.
    Residues 432 Isoelectric Point 6.53
    Sequence mtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanadawvthcenvcq qwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhlddqcetfllalkrgsgpagls amaevsefagtrlirpllartrgelvqwarqydlrwiedesnqddsydrnflrlrvvpllqqrwphfae atarsaalcaeqeslldelladdlahcqspqgtlqivpmlamsdarraaiirrwlagqnapmpsrdalv riwqevalaredaspclrlgafeirryqsqlwwiksvtgqsenivpwqtwlqplelpaglgsvqlnagg dirppradeavsvrfkapgllhivgrnggrklkkiwqelgvppwlrdttpllfygetliaaagvfvtqe gvaegengvsfvwqktls
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.65 Rfree 0.293
    Matthews' coefficent 2.77 Rfactor 0.223
    Waters 193 Solvent Content 55.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ni5
    1. A functional proteomics approach links the ubiquitin-related modifier Urm1 to a tRNA modification pathway
    CD Schlieker, AG Van der Veen - Proceedings of the , 2008 - National Acad Sciences
     
    2. Molecular mechanism of lysidine synthesis that determines tRNA identity and codon recognition
    Y Ikeuchi, A Soma, T Ote, J Kato, Y Sekine, T Suzuki - Molecular cell, 2005 - Elsevier
     
    3. Crystal Structure of Bacillus anthracis ThiI, a tRNA-modifying Enzyme Containing the Predicted RNA-binding THUMP Domain
    DG Waterman, M Ortiz-Lombarda, MJ Fogg - Journal of molecular , 2006 - Elsevier
     
    4. Structural basis for lysidine formation by ATP pyrophosphatase accompanied by a lysine-specific loop and a tRNA-recognition domain
    K Nakanishi, S Fukai, Y Ikeuchi - Proceedings of the , 2005 - National Acad Sciences
     
    5. Structure, dynamics, and function of RNA modification enzymes
    R Ishitani, S Yokoyama, O Nureki - Current opinion in structural biology, 2008 - Elsevier
     
    6. Structural basis for translational fidelity ensured by transfer RNA lysidine synthetase
    K Nakanishi, L Bonnefond, S Kimura, T Suzuki - Nature, 2009 - nature.com
     
    7. Structural Basis of the Initial Binding of tRNAIle Lysidine Synthetase TilS with ATP and L-Lysine
    M Kuratani, Y Yoshikawa, Y Bessho, K Higashijima - Structure, 2007 - Elsevier
     
    8. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     
    9. Discovery and characterization of tRNAIle lysidine synthetase (TilS)
    T Suzuki, K Miyauchi - FEBS letters, 2010 - Elsevier
     
    10. Old fold in a new X_ray diffraction dataset? Low_resolution molecular replacement using representative structural templates can provide phase information
    M Rajavel, T Warrier, B Gopal - Proteins: Structure, Function, , 2006 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch