.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nkq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crtystal Structure of Yeast Hypothetical Protein YNQ8_YEAST. To be Published
    Site NYSGXRC
    PDB Id 1nkq Target Id NYSGXRC-P096
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8073,P53889 Molecular Weight 28790.53 Da.
    Residues 259 Isoelectric Point 8.80
    Sequence msynylkaarkiicigrnyaahikelnnstpkqpffflkptssivtplssslvkttrpanstfnglned gtnpgpifiprgvkvhheielalivskhlsnvtkmkpeevydsisgvalaldltarnvqdeakkkglpw tiskgfdtfmpisaivsrekfssyksnlqdifrvkcsvngqlrqdggtnlmlhplhkilqhistmisle pgdiiltgtpagvgelkpgdrvhcellqnndnivdmnfecenrpgpyefret
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.20 Rfree 0.262
    Matthews' coefficent 2.25 Rfactor 0.216
    Waters 634 Solvent Content 45.28

    Ligand Information
    Ligands SO4 (SULFATE) x 7;ACY (ACETIC) x 12
    Metals CA (CALCIUM) x 6

    Jmol

     
    Google Scholar output for 1nkq
    1. Protein production by auto-induction in high-density shaking cultures
    FW Studier - Protein expression and purification, 2005 - Elsevier
     
    2. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    3. X-ray structure of fumarylacetoacetate hydrolase family member Homo sapiens FLJ36880
    BA Manjasetty, FH Niesen, H Delbruck, F Gotz - Biological , 2004 - molgen.mpg.de
     
    4. Structural Insight into Substrate Binding and Catalysis of a Novel 2-Keto-3- deoxy-d-arabinonate Dehydratase Illustrates Common Mechanistic Features of the
    SJJ Brouns, TRM Barends, P Worm, J Akerboom - Journal of molecular , 2008 - Elsevier
     
    5. Mathematical Modeling and Screening of Ligand Binding Sites in Protein using the Tetrahedral Motif Method and Double-Centroid Representation
    VM Reyes - 2012 - ritdml.rit.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch