.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nlx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure oh Phl p 6, a major timothy grass pollen allergen co-crystallized with Zinc. To be Published
    Site NYSGXRC
    PDB Id 1nlx Target Id NYSGXRC-T746
    Molecular Characteristics
    Source Phleum pratense
    Alias Ids TPS8118,P43215 Molecular Weight 13920.02 Da.
    Residues 132 Isoelectric Point 5.31
    Sequence mvamflavavvlglatsptaeggkatteeqkliedvnasfraamattanvppadkyktfeaaftvsskr nladavskapqlvpkldevynaaynaadhaapedkyeafvlhfsealriiagtpevhavkpga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 14
    Resolution (Å) 2.80 Rfree 0.272
    Matthews' coefficent 2.85 Rfactor 0.243
    Waters Solvent Content 55.19

    Ligand Information
    Ligands ARS (ARSENIC) x 7
    Metals ZN (ZINC) x 28

    Jmol

     
    Google Scholar output for 1nlx
    1. Crystal structure of yeast Ypr118w, a methylthioribose-1-phosphate isomerase related to regulatory eIF2B subunits
    M Bumann, S Djafarzadeh, AE Oberholzer - Journal of Biological , 2004 - ASBMB
     
    2. Genetic engineering of the major timothy grass pollen allergen, Phl p 6, to reduce allergenic activity and preserve immunogenicity
    S Vrtala, M Focke, J Kopec, P Verdino - The Journal of , 2007 - Am Assoc Immnol
     
    3. Structural analysis of linear and conformational epitopes of allergens
    O Ivanciuc, CH Schein, T Garcia, N Oezguen - Regulatory Toxicology , 2009 - Elsevier
     
    4. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    5. Structural characterziation of pollen allergens
    P Verdino - Clinical reviews in allergy and immunology, 2006 - Springer
     
    6. Generation of a low Immunoglobulin E_binding mutant of the timothy grass pollen major allergen Phl p 5a
    M Wald, H Kahlert, B Weber, M Jankovic - Clinical & , 2007 - Wiley Online Library
     
    7. Allergen structures and biologic functions: the cutting edge of allergy research
    A Poms - Current allergy and asthma reports, 2008 - Springer
     
    8. Self-assembly, modularity, and physical complexity
    SE Ahnert, IG Johnston, TMA Fink, JPK Doye, AA Louis - Physical Review E, 2010 - APS
     
    9. Structural analysis of linear and conformational epitopes of allergens
    W Braun, CH Schein, T Barcia, N Oezguen - Same series of , 2008 - portal.ilsi.org
     
    10. Molecular biology of allergens: structure and immune recognition
    MD Chapman, A Poms, RC Aalberse - Allergy Frontiers: Epigenetics, , 2009 - Springer
     
    11. Hypoallergenic mutants of the timothy grass pollen allergen Phl p 5 generated by proline mutations
    M Wald, H Kahlert, G Reese, N Krontal - Archives of Allergy , 2012 - content.karger.com
     
    12. In vitro studies of the enzymes involved in fluorometabolite biosynthesis in Streptomyces cattleya
    SM Cross - 2009 - research-repository.st-andrews.ac.
     
    13. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     
    14. Antibody compositions specific for lgE, lgG4 and lgA epitopes as tools for the design of hypoallergenic molecules for specific immunotherapy
    I Braren, D Grunwald, D Spillner - EP Patent 2,022,507, 2009 - freepatentsonline.com
     
    15. Molecular characterisation of major allergens from mite (Lep d 2) and cat (Fel d 1)
    L Kaiser - 2004 - diss.kib.ki.se
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch