.
The Open Protein Structure Annotation Network
PDB Keyword
.

1npu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and functional analysis of the costimulatory receptor programmed death-1. Immunity 20 337-347 2004
    Site NYSGXRC
    PDB Id 1npu Target Id NYSGXRC-T749
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8119,Q15116 Molecular Weight 13164.05 Da.
    Residues 117 Isoelectric Point 5.28
    Sequence sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqdarfqiiqlpn rhdfhmnildtrrndsgiylcgaislhpkakieespgaelvvterile
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.228
    Matthews' coefficent 1.67 Rfactor 0.198
    Waters 73 Solvent Content 25.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1npu
    1. Crystal structure of a soluble CD28-Fab complex
    EJ Evans, RM Esnouf, R Manso-Sancho - Nature , 2005 - nature.com
     
    2. T cell immunoglobulin mucin-3 crystal structure reveals a galectin-9-independent ligand-binding surface
    E Cao, X Zang, UA Ramagopal, A Mukhopadhaya - Immunity, 2007 - Elsevier
     
    3. Mechanical stretching of proteinsa theoretical survey of the Protein Data Bank
    JI Su_kowska, M Cieplak - Journal of Physics: Condensed Matter, 2007 - iopscience.iop.org
     
    4. The PD-1/PD-L1 complex resembles the antigen-binding Fv domains of antibodies and T cell receptors
    DY Lin, Y Tanaka, M Iwasaki, AG Gittis - Proceedings of the , 2008 - National Acad Sciences
     
    5. Structural determinants of herpesvirus entry mediator recognition by murine B and T lymphocyte attenuator
    CA Nelson, MD Fremont, JR Sedy - The Journal of , 2008 - Am Assoc Immnol
     
    6. IMGT Colliers de Perles and IgSF domain standardization for T cell costimulatory activatory (CD28, ICOS) and inhibitory (CTLA4, PDCD1 and BTLA) receptors
    VP Garapati, MP Lefranc - Developmental & Comparative Immunology, 2007 - Elsevier
     
    7. Sequence, structure, function, immunity: structural genomics of costimulation
    K Chattopadhyay, E Lazar_Molnar, Q Yan - Immunological , 2009 - Wiley Online Library
     
    8. Comparative protein modeling
    EX Esposito, D Tobi, JD Madura - Reviews in computational , 2006 - Wiley Online Library
     
    9. SDOCK: A global protein_protein docking program using stepwise force_field potentials
    C Zhang, L Lai - Journal of Computational Chemistry, 2011 - Wiley Online Library
     
    10. Rigid-body ligand recognition drives cytotoxic T-lymphocyte antigen 4 (CTLA-4) receptor triggering
    C Yu, AFP Sonnen, R George, BH Dessailly - Journal of Biological , 2011 - ASBMB
     
    11. Structural Biology of Disulfide Bond Formation
    D Fass - Annual Review of Biophysics, 2012 - annualreviews.org
     
    12. Comparative Protein Modeling
    JD Maduraz - Reviews in Computational Chemistry, 2006 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch