.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nr0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Identification of Functional Residues on Caenorhabditis elegans Actin-interacting Protein 1 (UNC-78) for Disassembly of Actin Depolymerizing Factor/Cofilin-bound Actin Filaments. J.Biol.Chem. 279 31697-31707 2004
    Site NYSGXRC
    PDB Id 1nr0 Target Id NYSGXRC-T745
    Related PDB Ids 1pev 
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS8116,Q11176 Molecular Weight 65319.66 Da.
    Residues 611 Isoelectric Point 6.57
    Sequence msefsqtalfpslprtargtavvlgntpagdkiqycngtsvytvpvgsltdteiytehshqttvaktsp sgyycasgdvhgnvriwdttqtthilkttipvfsgpvkdiswdseskriaavgegrerfghvflfdtgt sngnltgqaramnsvdfkpsrpfriisgsddntvaifegppfkfkstfgehtkfvhsvrynpdgslfas tggdgtivlyngvdgtktgvfeddslknvahsgsvfgltwspdgtkiasasadktikiwnvatlkvekt ipvgtriedqqlgiiwtkqalvsisangfinfvnpelgsidqvryghnkaitalsssadgktlfsadae ghinswdistgisnrvfpdvhatmitgikttskgdlftvswddhlkvvpaggsgvdsskavanklssqp lglavsadgdiavaacykhiaiyshgkltevpisynsscvalsndkqfvavggqdskvhvyklsgasvs evktivhpaeitsvafsnngaflvatdqsrkvipysvannfelahtnswtfhtakvacvswspdnvrla tgsldnsvivwnmnkpsdhpiiikgahamssvnsviwlnettivsagqdsnikfwnvpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23
    Matthews' coefficent 2.21 Rfactor 0.199
    Waters 709 Solvent Content 44.45

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 1

    Jmol

     
    Google Scholar output for 1nr0
    1. Regulation of actin filament dynamics by actin depolymerizing factor/cofilin and actin-interacting protein 1: new blades for twisted filaments
    S Ono - Biochemistry, 2003 - ACS Publications
     
    2. Phosphorylation-induced autoinhibition regulates the cytoskeletal protein Lethal (2) giant larvae
    J Betschinger, F Eisenhaber, JA Knoblich - Current biology, 2005 - Elsevier
     
    3. Identification of functional residues on Caenorhabditis elegans actin-interacting protein 1 (UNC-78) for disassembly of actin depolymerizing factor/cofilin-bound actin
    K Mohri, S Vorobiev, AA Fedorov, SC Almo - Journal of Biological , 2004 - ASBMB
     
    4. Bioinformatic analyses implicate the collaborating meiotic crossover/chiasma proteins Zip2, Zip3, and Spo22/Zip4 in ubiquitin labeling
    J Perry, N Kleckner, GV Brner - Proceedings of the , 2005 - National Acad Sciences
     
    5. WD40 proteins propel cellular networks
    CU Stirnimann, E Petsalaki, RB Russell - Trends in biochemical , 2010 - Elsevier
     
    6. The WD40 domain is required for LRRK2 neurotoxicity
    ND Jorgensen, Y Peng, CCY Ho, HJ Rideout, D Petrey - PLoS One, 2009 - dx.plos.org
     
    7. Structure and function of WD40 domain proteins
    C Xu, J Min - Protein & cell, 2011 - Springer
     
    8. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system
    TK Footz, JL Johnson, S Dubois, N Boivin - Human molecular , 2009 - Oxford Univ Press
     
    9. A novel Phe171Cys mutation in integrin _IIb causes Glanzmann thrombasthenia by abrogating _IIb_3 complex formation
    N Rosenberg, M Landau, J Luboshitz - of Thrombosis and , 2004 - Wiley Online Library
     
    10. Coverage of whole proteome by structural genomics observed through protein homology modeling database
    K Yura, A Yamaguchi, M Go - Journal of structural and functional genomics, 2006 - Springer
     
    11. Insights into the interaction of sortilin with proneurotrophins: a computational approach
    A Paiardini, V Caputo - Neuropeptides, 2008 - Elsevier
     
    12. Mutant WDR36 directly affects axon growth of retinal ganglion cells leading to progressive retinal degeneration in mice
    ZL Chi, F Yasumoto, Y Sergeev, M Minami - Human molecular , 2010 - Oxford Univ Press
     
    13. Cholera-and anthrax-like toxins are among several new ADP-ribosyltransferases
    RJ Fieldhouse, Z Turgeon, D White - PLoS computational , 2010 - dx.plos.org
     
    14. Enhanced stability of cis Pro-Pro peptide bond in Pro-Pro-Phe sequence motif
    B Dasgupta, P Chakrabarti, G Basu - FEBS letters, 2007 - Elsevier
     
    15. Is Asp_His_Ser/Thr_Trp tetrad hydrogen_bond network important to WD40_repeat proteins: A statistical and theoretical study
    XH Wu, H Zhang, YD Wu - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    16. Hot Macromolecular Crystals
    KD Koclega, M Chruszcz, MD Zimmerman - Crystal growth & , 2009 - ACS Publications
     
    17. The automatic detection of known _-propeller structural motifs from protein tertiary structure
    A Kotu, K Guruprasad - International journal of biological macromolecules, 2005 - Elsevier
     
    18. Mechanisms of pseudosubstrate inhibition of the anaphase promoting complex by Acm1
    JL Burton, Y Xiong, MJ Solomon - The EMBO Journal, 2011 - nature.com
     
    19. Protein Structure Database for Structural Genomics Group
    JY Lau - 2005 - www-nmr.cabm.rutgers.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch