.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nvt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of shikimate 5-dehydrogenase (SDH) bound to NADP: insights into function and evolution. Structure 11 1005-1013 2003
    Site NYSGXRC
    PDB Id 1nvt Target Id NYSGXRC-T576
    Molecular Characteristics
    Source Methanococcus jannaschii.
    Alias Ids TPS8113,Q58484 Molecular Weight 30875.44 Da.
    Residues 282 Isoelectric Point 5.56
    Sequence minaktkviglighpvehsfspimhnaafkdkglnyvyvafdvlpenlkyvidgakalgivgfnvtiph kieimkyldeidkdaqligavntikiedgkaigyntdgigarmaleeeigrvkdkniviygaggaarav afelakdnniiianrtvekaealakeiaeklnkkfgeevkfsgldvdldgvdiiinatpigmypnidve pivkaeklredmvvmdliynpletvllkeakkvnaktinglgmliyqgavafkiwtgvepnievmknai idkitk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.26
    Matthews' coefficent 2.58 Rfactor 0.224
    Waters 139 Solvent Content 51.98

    Ligand Information
    Ligands NAP (NADP) x 2
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1nvt
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. CASP5 target classification
    LN Kinch, Y Qi, TJP Hubbard - : Structure, Function, and , 2003 - Wiley Online Library
     
    4. Crystal Structure of Shikimate 5-Dehydrogenase (SDH) Bound to NADP:: Insights into Function and Evolution
    AK Padyana, SK Burley - Structure, 2003 - Elsevier
     
    5. Predicting small ligand binding sites in proteins using backbone structure
    AJ Bordner - Bioinformatics, 2008 - Oxford Univ Press
     
    6. A structural pattern_based method for protein fold recognition
    WR Taylor, I Jonassen - PROTEINS: Structure, Function, and , 2004 - Wiley Online Library
     
    7. Structural studies of shikimate 5_dehydrogenase from Mycobacterium tuberculosis
    HA Arcuri, JC Borges, IO Fonseca - Proteins: Structure, , 2008 - Wiley Online Library
     
    8. Evolutionary trace annotation of protein function in the structural proteome
    S Erdin, RM Ward, E Venner, O Lichtarge - Journal of molecular biology, 2010 - Elsevier
     
    9. Site-directed mutagenesis of the active site region in the quinate/shikimate 5-dehydrogenase YdiB of Escherichia coli
    HA Lindner, G Nadeau, A Matte, G Michel - Journal of Biological , 2005 - ASBMB
     
    10. A thermostable shikimate 5_dehydrogenase from the archaeon Archaeoglobus fulgidus
    S Lim, I Schrder - FEMS microbiology , 2004 - Wiley Online Library
     
    11. Crystal structures of shikimate dehydrogenase AroE from Thermus thermophilus HB8 and its cofactor and substrate complexes: insights into the enzymatic mechanism
    B Bagautdinov, N Kunishima - Journal of molecular biology, 2007 - Elsevier
     
    12. Structural and biochemical analyses of shikimate dehydrogenase AroE from Aquifex aeolicus: implications for the catalytic mechanism
    J Gan, Y Wu, P Prabakaran, Y Gu, Y Li - Biochemistry, 2007 - ACS Publications
     
    13. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    14. Kinetic and chemical mechanisms of shikimate dehydrogenase from Mycobacterium tuberculosis
    IO Fonseca, RG Silva, CL Fernandes - Archives of biochemistry , 2007 - Elsevier
     
    15. X_ray crystallographic and enzymatic analyses of shikimate dehydrogenase from Staphylococcus epidermidis
    C Han, T Hu, D Wu, S Qu, J Zhou, J Ding - FEBS , 2009 - Wiley Online Library
     
    16. 1.6 A structure of an NAD+-dependent quinate dehydrogenase from Corynebacterium glutamicum
    J Schoepe, K Niefind, D Schomburg - Acta Crystallographica Section , 2008 - scripts.iucr.org
     
    17. Partial Geometric Hashing for Retrieving Similar Interaction Protein Using Profile
    Y Kiuchi, T Ozaki, T Ohkawa - Information Technology, 2007. , 2007 - ieeexplore.ieee.org
     
    18. Protein Structure Prediction Using an Augmented Homology Modeling Method: Key Importance of Iterative-Procedures for Obtaining Consistent Quality Models
    S McDonald, S Mylvaganam - Current , 2005 - ingentaconnect.com
     
    19. High-resolution structure of shikimate dehydrogenase from Thermotoga maritima reveals a tightly closed conformation
    HH Lee - Molecules and Cells, 2011 - Springer
     
    20. Retrieval of Protein with Similar Interaction Based on Structural Data of Protein-compound Complex
    Y NONOMURA, K YOSHINO, T NAKAE, T OKAWA - Transactions, 2006 - sciencelinks.jp
     
    21. ___-_______________________________ (_____________, _ 11 _ MPS ______: ___________)
    ______ _____ _____ ____ - _________. __ , 2006 - ci.nii.ac.jp
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch