.
The Open Protein Structure Annotation Network
PDB Keyword
.

1omi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes. To be Published
    Site NYSGXRC
    PDB Id 1omi Target Id NYSGXRC-T143
    Molecular Characteristics
    Source Listeria monocytogene
    Alias Ids TPS8107,P22262 Molecular Weight 28317.17 Da.
    Residues 248 Isoelectric Point 8.66
    Sequence gshmasmtggqqmgrgsefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtim nlqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsys lakfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqe kvivyknscfyvqnldylkryapkldewfylacpatwgkln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.80 Rfree 0.278
    Matthews' coefficent 2.62 Rfactor 0.244
    Waters Solvent Content 51.29

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1omi
    1. The mutation G145S in PrfA, a key virulence regulator of Listeria monocytogenes, increases DNA_binding affinity by stabilizing the HTH motif
    M Eiting, G Hagelken, WD Schubert - Molecular , 2005 - Wiley Online Library
     
    2. New Listeria monocytogenes prfA* mutants, transcriptional properties of PrfA* proteins and structurefunction of the virulence regulator PrfA
    Y Vega, M Rauch, MJ Banfield - Molecular , 2004 - Wiley Online Library
     
    3. A novel mutation within the central Listeria monocytogenes regulator PrfA that results in constitutive expression of virulence gene products
    KKY Wong, NE Freitag - Journal of bacteriology, 2004 - Am Soc Microbiol
     
    4. On the use of DXMS to produce more crystallizable proteins: structures of the T. maritima proteins TM0160 and TM1171
    G Spraggon, D Pantazatos, HE Klock, IA Wilson - Protein , 2004 - Wiley Online Library
     
    5. Global gene expression mediated by Thermus thermophilus SdrP, a CRP/FNR family transcriptional regulator
    Y Agari, A Kashihara, S Yokoyama - Molecular , 2008 - Wiley Online Library
     
    6. A naturally occurring mutation K220T in the pleiotropic activator PrfA of Listeria monocytogenes results in a loss of virulence due to decreasing DNA-binding affinity
    P Velge, M Herler, J Johansson, SM Roche - , 2007 - Soc General Microbiol
     
    7. Hot Macromolecular Crystals
    KD Koclega, M Chruszcz, MD Zimmerman - Crystal growth & , 2009 - ACS Publications
     
    8. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch