.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the Periplasmic divalent cation tolerance protein CutA from Archaeoglobus fulgidus. To be Published 2003
    Site NYSGXRC
    PDB Id 1p1l Target Id NYSGXRC-T835
    Molecular Characteristics
    Source Archaeoglobus fulgidus.
    Alias Ids TPS8146,O28301 Molecular Weight 11884.22 Da.
    Residues 102 Isoelectric Point 5.47
    Sequence mhnfiyitapsleeaeriakrllekklaacvnifpiksffwwegkieaatefamivktrsekfaevrde vkamhsyttpcicaipierglkefldwidetve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.229
    Matthews' coefficent 2.51 Rfactor 0.207
    Waters 56 Solvent Content 50.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1p1l
    1. Structure of the BH3 domains from the p53-inducible BH3-only proteins Noxa and Puma in complex with Mcl-1
    CL Day, C Smits, FC Fan, EF Lee, WD Fairlie - Journal of molecular , 2008 - Elsevier
     
    2. Finding functional sites in structural genomics proteins
    A Stark, A Shkumatov, RB Russell - Structure, 2004 - Elsevier
     
    3. Determining protein topology from skeletons of secondary structures
    Y Wu, M Chen, M Lu, Q Wang, J Ma - Journal of molecular biology, 2005 - Elsevier
     
    4. Post to
    A Paiardini, R Sali, F Bossa - BMC structural , 2008 - biomedcentral.com
     
    5. Searching distant homologs of the regulatory ACT domain in phenylalanine hydroxylase
    J Siltberg-Liberles, A Martinez - Amino acids, 2009 - Springer
     
    6. New targets for an old drug
    LM Toledo-Sherman, L Desouza, CM Hosfield, L Liao - Clinical Proteomics, 2004 - Springer
     
    7. Crystal structure of a transcription regulator (TM1602) from Thermotoga maritima at 2.3 resolution
    D Weekes, MD Miller, S Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    8. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    9. METHODS AND COMPOSITIONS FOR THE TREATMENT OF CANCERS AND PATHOGENIC INFECTIONS
    WA Dunn, DE Akin, BK Law - US Patent App. 13/389,476, 2010 - Google Patents
     
    10. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    11. Modeling Protein Structures Based on Density Maps at Intermediate Resolutions
    J Ma - Computational Methods for Protein Structure Prediction , 2007 - Springer
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch