.
The Open Protein Structure Annotation Network
PDB Keyword
.

1p1m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the hypothetical protein TM0936 from Thermotoga maritima at 1.5A bound to Ni and methionine. To be Published 2003
    Site NYSGXRC
    PDB Id 1p1m Target Id NYSGXRC-455f
    Related PDB Ids 2plm 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9397,NP_228744.1, PF01979 Molecular Weight 45638.93 Da.
    Residues 405 Isoelectric Point 5.16
    Sequence iignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpalfnththapmtllrgvaedl sfeewlfskvlpiedrltekmayygtilaqmemarhgiagfvdmyfheewiakavrdfgmralltrglv dsngddggrleenlklynewngfegrifvgfgphspylcseeylkrvfdtakslnapvtihlyetskee ydledilniglkevktiaahcvhlperyfgvlkdipffvshnpasnlklgngiapvqrmiehgmkvtlg tdgaasnnslnlffemrlasllqkaqnprnldvntclkmvtydgaqamgfksgkieegwnadlvvidld lpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelariekelyss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.213
    Matthews' coefficent 2.83 Rfactor 0.201
    Waters 521 Solvent Content 56.20

    Ligand Information
    Ligands MET x 1
    Metals NI (NICKEL) x 1

    Jmol

     
    Google Scholar output for 1p1m
    1. Structure-based activity prediction for an enzyme of unknown function
    JC Hermann, R Marti-Arbona, AA Fedorov, E Fedorov - Nature, 2007 - nature.com
     
    2. Long loop prediction using the protein local optimization program
    K Zhu, DL Pincus, S Zhao - : Structure, Function, and , 2006 - Wiley Online Library
     
    3. High-throughput computational and experimental techniques in structural genomics
    MR Chance, A Fiser, A Sali, U Pieper, N Eswar - Genome , 2004 - gb.cw.com.tw
     
    4. Metalloproteomics: high-throughput structural and functional annotation of proteins in structural genomics
    W Shi, C Zhan, A Ignatov, BA Manjasetty, N Marinkovic - Structure, 2005 - Elsevier
     
    5. Prediction of protein loop conformations using the AGBNP implicit solvent model and torsion angle sampling
    AK Felts, E Gallicchio, D Chekmarev - Journal of chemical , 2008 - ACS Publications
     
    6. Annotating enzymes of unknown function: N-formimino-L-glutamate deiminase is a member of the amidohydrolase superfamily
    R Mart-Arbona, C Xu, S Steele, A Weeks, GF Kuty - Biochemistry, 2006 - ACS Publications
     
    7. Multiscale optimization of a truncated Newton minimization algorithm and application to proteins and protein-ligand complexes
    K Zhu, MR Shirts, RA Friesner - Journal of Chemical , 2007 - ACS Publications
     
    8. At the periphery of the amidohydrolase superfamily: Bh0493 from Bacillus halodurans catalyzes the isomerization of D-galacturonate to D-tagaturonate
    TT Nguyen, S Brown, AA Fedorov, EV Fedorov - Biochemistry, 2008 - ACS Publications
     
    9. Computational approaches for protein function prediction: A combined strategy from multiple sequence alignment to molecular docking-based virtual screening
    CL Pierri, G Parisi, V Porcelli - et Biophysica Acta (BBA)-Proteins & , 2010 - Elsevier
     
    10. Structural characterization of the zinc binding domain in cytosolic PSD_95 interactor (cypin): Role of zinc binding in guanine deamination and dendrite branching
    JR Fernndez, WJ Welsh - : Structure, Function, and , 2008 - Wiley Online Library
     
    11. Development of a new physics_based internal coordinate mechanics force field and its application to protein loop modeling
    YA Arnautova, RA Abagyan - : Structure, Function, and , 2011 - Wiley Online Library
     
    12. Structure prediction of domain insertion proteins from structures of individual domains
    M Berrondo, M Ostermeier, JJ Gray - Structure, 2008 - Elsevier
     
    13. Discovery and structure determination of the orphan enzyme isoxanthopterin deaminase
    RS Hall, R Agarwal, D Hitchcock, JM Sauder - Biochemistry, 2010 - ACS Publications
     
    14. The Enzyme Function Initiative
    JA Gerlt, KN Allen, SC Almo, RN Armstrong - Biochemistry, 2011 - ACS Publications
     
    15. Identification of family-specific residue packing motifs and their use for structure-based protein function prediction: II. Case studies and applications
    D Bandyopadhyay, J Huan, J Prins, J Snoeyink - Journal of computer- , 2009 - Springer
     
    16. Active Site Detection by Spatial Conformity and Electrostatic AnalysisUnravelling a Proteolytic Function in Shrimp Alkaline Phosphatase
    S Chakraborty, R Minda, L Salaye, SK Bhattacharjee - PloS one, 2011 - dx.plos.org
     
    17. Structure to function
    JD Watson, JM Thornton, ML Tress, G Lopez - 2008 - books.google.com
     
    18. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    19. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     
    20. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     
    21. Predicting the structure and function of protein mutants
    M Berrondo - Dissertation Abstracts International, 2010 - graylab.jhu.edu
     
    22. Structural characterization and transcriptional regulation of the cytosolic PSD-95 interacting protein (CYPIN) and its role in neuronal dendrite branching
    JR Fernandez - 2008 - books.google.com
     
    23. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch