.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pqw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative enoyl reductase domain of polyketide synthase. To be Published
    Site NYSGXRC
    PDB Id 1pqw Target Id NYSGXRC-T109
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS8092,7448840 Molecular Weight 25594.87 Da.
    Residues 243 Isoelectric Point 5.62
    Sequence evgqrviafgpgtfgthlgtiadlvvpipdtladneaatfgvayltawhslcevgrlspgervlihsat ggvgmaavsiakmigariyttagsdakremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslag eaiqrgvqilapggrfielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhva dgklevlpvtafslhdaadafrlmasgkhtgkivis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.66 Rfree 0.228
    Matthews' coefficent 2.66 Rfactor 0.197
    Waters 141 Solvent Content 53.76

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1pqw
    1. Architecture of mammalian fatty acid synthase at 4.5 resolution
    T Maier, S Jenni, N Ban - Science, 2006 - sciencemag.org
     
    2. The crystal structure of a mammalian fatty acid synthase
    T Maier, M Leibundgut, N Ban - Science, 2008 - sciencemag.org
     
    3. The structure of a ketoreductase determines the organization of the _-carbon processing enzymes of modular polyketide synthases
    AT Keatinge-Clay, RM Stroud - Structure, 2006 - Elsevier
     
    4. Versatility of polyketide synthases in generating metabolic diversity
    RS Gokhale, R Sankaranarayanan - Current opinion in , 2007 - Elsevier
     
    5. Structural genomics as an approach towards understanding the biology of tuberculosis
    EN Baker - Journal of structural and functional genomics, 2007 - Springer
     
    6. Autonomous folding of interdomain regions of a modular polyketide synthase
    CD Richter, DA Stanmore, RN Miguel - FEBS , 2007 - Wiley Online Library
     
    7. Experimental mapping of soluble protein domains using a hierarchical approach
    JD Pedelacq, HB Nguyen, S Cabantous - Nucleic acids , 2011 - Oxford Univ Press
     
    8. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     
    9. Divergence of multimodular polyketide synthases revealed by a didomain structure
    J Zheng, DC Gay, B Demeler, MA White - Nature Chemical , 2012 - nature.com
     
    10. The structures of type I polyketide synthases
    AT Keatinge-Clay - Natural Product Reports, 2012 - pubs.rsc.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch