.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pqy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of Escherichia coli YfdW, a type III CoA transferase. Acta Crystallogr.,Sect.D 60 507-511 2004
    Site NYSGXRC
    PDB Id 1pqy Target Id NYSGXRC-T783
    Related PDB Ids 1q6y 1q7e 
    Molecular Characteristics
    Source Escherichia coli.
    Alias Ids TPS8127,P77407 Molecular Weight 45825.75 Da.
    Residues 416 Isoelectric Point 5.36
    Sequence mstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyftmlnsnkrs ielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlifgsikgfdecspyvnvka yenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligllaallhrektgrgqrvtmsmqdavlnl crvklrdqqrldklgyleeypqypngtfgdavprggnaggggqpgwilkckgwetdpnayiyftiqeqn wentckaigkpewitdpaystaharqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeis ldpslrqsgsvveveqplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.211
    Matthews' coefficent 2.33 Rfactor 0.177
    Waters 260 Solvent Content 47.14

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pqy
    1. Structure of Escherichia coli YfdW, a type III CoA transferase
    A Gogos, J Gorman, L Shapiro - Acta Crystallographica Section D: , 2004 - scripts.iucr.org
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch