.
The Open Protein Structure Annotation Network
PDB Keyword
.

1psq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a probable thiol peroxidase from Streptococcus pneumoniae. To be Published
    Site NYSGXRC
    PDB Id 1psq Target Id NYSGXRC-T817
    Molecular Characteristics
    Source Streptococcus pneumoniae.
    Alias Ids TPS8140,P72500 Molecular Weight 18018.43 Da.
    Residues 163 Isoelectric Point 4.72
    Sequence mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicstqtrrfneel agldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallinewhllaravfvldtdnti ryveyvdninsepnfeaaiaaakal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.249
    Matthews' coefficent 2.37 Rfactor 0.2
    Waters 253 Solvent Content 47.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1psq
    1. Divergence of function in the thioredoxin fold suprafamily: evidence for evolution of peroxiredoxins from a thioredoxin-like ancestor
    SD Copley, WRP Novak, PC Babbitt - Biochemistry, 2004 - ACS Publications
     
    2. Crystal structure of a novel Plasmodium falciparum 1-Cys peroxiredoxin
    GN Sarma, C Nickel, S Rahlfs, M Fischer - Journal of molecular , 2005 - Elsevier
     
    3. Structural survey of the peroxiredoxins
    PA Karplus, A Hall - Peroxiredoxin systems, 2007 - Springer
     
    4. Crystal structure and solution NMR dynamics of a D (type II) peroxiredoxin glutaredoxin and thioredoxin dependent: a new insight into the peroxiredoxin oligomerism
    A Echalier, X Trivelli, C Corbier, N Rouhier - Biochemistry, 2005 - ACS Publications
     
    5. Crystal Structure of AhpE from Mycobacterium tuberculosis, a 1-Cys Peroxiredoxin
    S Li, NA Peterson, MY Kim, CY Kim, LW Hung - Journal of molecular , 2005 - Elsevier
     
    6. Mechanisms of protein evolution and their application to protein engineering
    ME Glasner, JA Gerlt, PC Babbitt - Advances in Enzymology, 2007 - Wiley Online Library
     
    7. The immunophilin FKBP52 specifically binds to tubulin and prevents microtubule formation
    B Chambraud, H Belabes, V Fontaine-Lenoir - The FASEB Journal, 2007 - FASEB
     
    8. Functional and Structural Characterization of a Thiol Peroxidase from Mycobacterium tuberculosis
    BS Rho, LW Hung, JM Holton, D Vigil, SI Kim - Journal of molecular , 2006 - Elsevier
     
    9. Structure of the inactive variant C60S of Mycobacterium tuberculosis thiol peroxidase
    M Stehr, HJ Hecht, T Jager, L Flohe - Section D: Biological , 2006 - scripts.iucr.org
     
    10. Structural evidence that peroxiredoxin catalytic power is based on transition-state stabilization
    A Hall, D Parsonage, LB Poole, PA Karplus - Journal of molecular biology, 2010 - Elsevier
     
    11. Proteinprotein interactions within peroxiredoxin systems
    V Noguera-Mazon, I Krimm, O Walker - Photosynthesis , 2006 - Springer
     
    12. Analysis of the peroxiredoxin family: Using active_site structure and sequence information for global classification and residue analysis
    KJ Nelson, ST Knutson, L Soito - Proteins: Structure, , 2011 - Wiley Online Library
     
    13. Mitochondrial peroxiredoxins
    Z Cao, JG Lindsay, NW Isaacs - Peroxiredoxin Systems, 2007 - Springer
     
    14. The oxidized subunit B8 from human complex I adopts a thioredoxin fold
    C Brockmann, A Diehl, K Rehbein, H Strauss - Structure, 2004 - Elsevier
     
    15. Peroxiredoxin systems in mycobacteria
    T Jaeger - Peroxiredoxin Systems, 2007 - Springer
     
    16. Reversible conformational switch revealed by the redox structures of Bacillus subtilis thiol peroxidase
    J Lu, F Yang, Y Li, X Zhang, B Xia, C Jin - Biochemical and biophysical , 2008 - Elsevier
     
    17. Classification of peroxiredoxin subfamilies using regular expressions
    JK Chon_, J Choi_, S Soo - Genomics & Informatics, 2005 - genominfo.org
     
    18. Crystallization and preliminary X-ray analysis of a truncated mutant of yeast nuclear thiol peroxidase, a novel atypical 2-Cys peroxiredoxin
    J Choi, S Choi, MK Cha, IH Kim - Crystallographica Section F , 2005 - scripts.iucr.org
     
    19. Crystal structure of the C107S/C112S mutant of yeast nuclear 2_Cys peroxiredoxin
    J Choi, S Choi, JK Chon, J Choi - Proteins: Structure, , 2005 - Wiley Online Library
     
    20. The structure of an orthorhombic crystal form of aforced reduced'thiol peroxidase reveals lattice formation aided by the presence of the affinity tag
    KSH Beckham, O Byron, AJ Roe - Section F: Structural , 2012 - scripts.iucr.org
     
    21. Cloning, overexpression, purification, crystallization and preliminary X-ray diffraction analysis of an atypical two-cysteine peroxiredoxin (SAOUHSC_01822) from
    S Bhattacharyya, D Dutta, AK Ghosh - Section F: Structural , 2009 - scripts.iucr.org
     
    22. Caracterizacin bioqumica y molecular de una peroxirredoxina mitocondrial de Pisum sativum
    SB MEDINA - 2006 - hera.ugr.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch