.
The Open Protein Structure Annotation Network
PDB Keyword
.

1psu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the E. coli PaaI protein from the phyenylacetic acid degradation operon. To be Published
    Site NYSGXRC
    PDB Id 1psu Target Id NYSGXRC-2763a
    Related PDB Ids 2fs2 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS9399,PF02575, NP_415914.1 Molecular Weight 14718.79 Da.
    Residues 139 Isoelectric Point 6.26
    Sequence shkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsladtafayacns qglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqktvalfrgkshriggtitgea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.251
    Matthews' coefficent 2.75 Rfactor 0.22
    Waters 143 Solvent Content 54.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1psu
    1. The Hotdog fold: wrapping up a superfamily of thioesterases and dehydratases
    S Dillon, A Bateman - BMC bioinformatics, 2004 - biomedcentral.com
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Structure, function, and mechanism of the phenylacetate pathway hot dog-fold thioesterase PaaI
    F Song, Z Zhuang, L Finci, D Dunaway-Mariano - Journal of Biological , 2006 - ASBMB
     
    4. A structural model of the plant acyl-acyl carrier protein thioesterase FatB comprises two helix/4-stranded sheet domains, the N-terminal domain containing residues
    KM Mayer, J Shanklin - Journal of Biological Chemistry, 2005 - ASBMB
     
    5. Crystal structure of human thioesterase superfamily member 2
    Z Cheng, F Song, X Shan, Z Wei, Y Wang - Biochemical and , 2006 - Elsevier
     
    6. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch