.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pug

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of E. coli Ybab. To be Published
    Site NYSGXRC
    PDB Id 1pug Target Id NYSGXRC-T5
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8082,P17577 Molecular Weight 12014.24 Da.
    Residues 109 Isoelectric Point 5.01
    Sequence mfgkgglgnlmkqaqqmqekmqkmqeeiaqlevtgesgaglvkvtingahncrrveidpslleddkeml edlvaaafndaarrieetqkekmasvssgmqlppgfkmpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.28412
    Matthews' coefficent 3.13 Rfactor 0.21211
    Waters 163 Solvent Content 60.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pug
    1. Novel identification of expressed genes and functional classification of hypothetical proteins from Neisseria meningitidis serogroup A
    G Bernardini, S Arena, D Braconi, A Scaloni - , 2007 - Wiley Online Library
     
    2. Borrelia burgdorferi EbfC defines a newly-identified, widespread family of bacterial DNA-binding proteins
    SP Riley, T Bykowski, AE Cooley, LH Burns - Nucleic acids , 2009 - Oxford Univ Press
     
    3. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    4. DNA-binding by Haemophilus influenzae and Escherichia coli YbaB, members of a widely-distributed bacterial protein family
    AE Cooley, SP Riley, K Kral, MC Miller - BMC , 2009 - biomedcentral.com
     
    5. EbfC (YbaB) Is a New Type of Bacterial Nucleoid-Associated Protein and a Global Regulator of Gene Expression in the Lyme Disease Spirochete
    BL Jutras, A Bowman, CA Brissette - Journal of , 2012 - Am Soc Microbiol
     
    6. Genetic and biochemical characteristics of the histone-like protein DR0199 in Deinococcus radiodurans
    H Wang, F Wang, X Hua, T Ma, J Chen, X Xu - , 2012 - Soc General Microbiol
     
    7. Dynamic features of homo_dimer interfaces calculated by normal mode analysis
    Y Tsuchiya, K Kinoshita, S Endo, H Wako - Protein Science, 2012 - Wiley Online Library
     
    8. IN SILICO SCREENING SYSTEM AND IN SILICO SCREENING METHOD
    H Umeyama, D Takaya, M Shitaka - EP Patent , 2010 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch