.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pui

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of an EngB GTPase. To be Published
    Site NYSGXRC
    PDB Id 1pui Target Id NYSGXRC-T16
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8084,P24253 Molecular Weight 23559.69 Da.
    Residues 210 Isoelectric Point 6.86
    Sequence mtnlnyqqthfvmsapdirhlpsdtgievafagrsnagkssalntltnqkslartsktpgrtqlinlfe vadgkrlvdlpgygyaevpeemkrkwqralgeylekrqslqglvvlmdirhplkdldqqmiewavdsni avlvlltkadklasgarkaqlnmvreavlafngdvqvetfsslkkqgvdklrqkldtwfsemqpveetq dge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.262
    Matthews' coefficent 2.57 Rfactor 0.24
    Waters 200 Solvent Content 51.80

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 1pui
    1. Structure-function relationships of the G domain, a canonical switch motif
    A Wittinghofer, IR Vetter - Annual review of biochemistry, 2011 - annualreviews.org
     
    2. CPSARST: an efficient circular permutation search tool applied to the detection of novel protein structural relationships
    WC Lo, PC Lyu - Genome biology, 2008 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch