.
The Open Protein Structure Annotation Network
PDB Keyword
.

1puj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the YlqF GTPase from B. subtilis. To be Published
    Site NYSGXRC
    PDB Id 1puj Target Id NYSGXRC-T18
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8085,O31743 Molecular Weight 31984.52 Da.
    Residues 282 Isoelectric Point 9.14
    Sequence mtiqwfpghmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavtq qwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigipnvgkstlin rlakkniaktgdrpgittsqqwvkvgkelelldtpgilwpkfedelvglrlavtgaikdsiinlqdvav fglrfleehyperlkerygldeipediaelfdaigekrgclmsgglinydktteviirdirtekfgrls feqptm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.25
    Matthews' coefficent 2.08 Rfactor 0.216
    Waters 163 Solvent Content 40.50

    Ligand Information
    Ligands GNP (PHOSPHOAMINOPHOSPHONIC) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1puj
    1. Progress of structural genomics initiatives: an analysis of solved target structures
    AE Todd, RL Marsden, JM Thornton - Journal of molecular , 2005 - Elsevier
     
    2. The Crystal Structure of YloQ, a Circularly Permuted GTPase Essential for Bacillus subtilis Viability
    VM Levdikov, EV Blagova, JA Brannigan - Journal of molecular , 2004 - Elsevier
     
    3. A novel conserved family of nitric oxide synthase?
    T Zemojtel, T Penzkofer, T Dandekar - Trends in biochemical , 2004 - Elsevier
     
    4. Structural stabilization of GTP-binding domains in circularly permuted GTPases: implications for RNA binding
    B Anand, SK Verma, B Prakash - Nucleic acids research, 2006 - Oxford Univ Press
     
    5. Role of GTPases in bacterial ribosome assembly
    RA Britton - Annual review of microbiology, 2009 - annualreviews.org
     
    6. Structure-function relationships of the G domain, a canonical switch motif
    A Wittinghofer, IR Vetter - Annual review of biochemistry, 2011 - annualreviews.org
     
    7. Analysis of GTPases carrying hydrophobic amino acid substitutions in lieu of the catalytic glutamine: implications for GTP hydrolysis
    R Mishra, SK Gara, S Mishra - : Structure, Function, and , 2005 - Wiley Online Library
     
    8. Isolation and characterization of a dominant negative mutant of Bacillus subtilis GTP-binding protein, YlqF, essential for biogenesis and maintenance of the 50 S
    Y Matsuo, T Oshima, PC Loh, T Morimoto - Journal of Biological , 2007 - ASBMB
     
    9. A novel lysine-rich domain and GTP binding motifs regulate the nucleolar retention of human guanine nucleotide binding protein, GNL3L
    MRK Rao, G Kumari, D Balasundaram - Journal of molecular , 2006 - Elsevier
     
    10. Crystal structure of YlqF, a circularly permuted GTPase: Implications for its GTPase activation in 50 S ribosomal subunit assembly
    DJ Kim, JY Jang, HJ Yoon - : Structure, Function, and , 2008 - Wiley Online Library
     
    11. cpRAS: a novel circularly permuted RAS-like GTPase domain with a highly scattered phylogenetic distribution
    M Elias, M Novotny - Biology direct, 2008 - biomedcentral.com
     
    12. Signals and Pathways Regulating Nucleolar Retention of Novel Putative Nucleolar GTPase, NGP-1 (GNL-2)
    V Chennupati, D Datta, RS Malireddi, N Boddapati - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch