.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pv1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural characterization and reversal of the natural organophosphate resistance of a D-type esterase, Saccharomyces cerevisiae S-formylglutathione hydrolase. Biochemistry 47 9592-9601 2008
    Site NYSGXRC
    PDB Id 1pv1 Target Id NYSGXRC-P068
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8069,P40363 Molecular Weight 33932.51 Da.
    Residues 299 Isoelectric Point 6.22
    Sequence mkvvkefsvcggrliklshnsnstktsmnvniylpkhyyaqdfprnkriptvfylsgltctpdnaseka fwqfqadkygfaivfpdtsprgdevandpegswdfgqgagfylnatqepyaqhyqmydyihkelpqtld shfnkngdvkldfldnvaitghsmggygaicgylkgysgkrykscsafapivnpsnvpwgqkafkgylg eekaqweaydpclliknirhvgddrilihvgdsdpfleehlkpellleavkatswqdyveikkvhgfdh syyfvstfvpehaefharnlgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.2982
    Matthews' coefficent 2.57 Rfactor 0.255
    Waters 122 Solvent Content 52.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pv1
    1. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    2. Structural Characterization and Reversal of the Natural Organophosphate Resistance of a D-Type Esterase, Saccharomyces cerevisiae S-Formylglutathione
    PM Legler, D Kumaran, S Swaminathan - Biochemistry, 2008 - ACS Publications
     
    3. Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
    D Wu, Y Li, G Song, D Zhang, N Shaw, ZJ Liu - The FASEB Journal, 2009 - FASEB
     
    4. Structure and dynamics of cold-adapted enzymes as investigated by FT-IR spectroscopy and MD. The case of an esterase from Pseudoalteromonas haloplanktis
    V Aurilia, JF Rioux-Dube_, A Marabotti - The Journal of , 2009 - ACS Publications
     
    5. Crystal structure of an S_formylglutathione hydrolase from Pseudoalteromonas haloplanktis TAC125
    V Alterio, V Aurilia, A Romanelli, A Parracino - , 2010 - Wiley Online Library
     
    6. Structure and Dynamics of Cold-Adapted Enzymes as Investigated by Phosphorescence Spectroscopy and Molecular Dynamics Studies. 2. The Case of an Esterase
    S D'Auria, V Aurilia, A Marabotti - The Journal of , 2009 - ACS Publications
     
    7. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    8. The structure of a putative S_formylglutathione hydrolase from Agrobacterium tumefaciens
    KE van Straaten, CF Gonzalez, RB Valladares - Protein , 2009 - Wiley Online Library
     
    9. Stochastic pairwise alignments and scoring methods for comparative protein structure modeling
    AC Marko, K Stafford, T Wymore - Journal of chemical information , 2007 - ACS Publications
     
    10. Structure and activity of the cold-active and anion-activated carboxyl esterase OLEI01171 from the oil-degrading marine bacterium Oleispira antarctica
    L Sofia, T Anatoli, P Pierre, F Robert - Biochemical , 2012 - biochemj.org
     
    11. A Role for His-160 in Peroxide Inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an Oxidation Sensitive Motif
    PM Legler, DH Leary, W Judson Hervey - Archives of Biochemistry , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch