.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pxy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the actin crosslinking core of fimbrin. Structure 12 999-1013 2004
    Site NYSGXRC
    PDB Id 1pxy Target Id NYSGXRC-T750
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS8120,O49963 Molecular Weight 76894.17 Da.
    Residues 687 Isoelectric Point 6.13
    Sequence msgyvgvvvsdpwlqsqftqvelrtlnskyvsvknqngkvtiedlpplfaklkalsatfkedeikgmlg elgsdtstdvsfeeflkiylnllskaaeksgghhknsssflkactttllhaiyqsekgpfvqhinrylg ddpflkqflpldphsnqlyelvkdgvllcklinvavpgtideraintkrvlnpwernenhtlclnsaka vgcsvvnigtqdlaegrphlvlglisqlikiqvladlnlkktpqlvelledsddveellrlppekvllk wmnfhlkkggykktvsnfsadlkdaqayafllnvlapehcdpatldakdpleraelvlshaermnckry ltaeeivegsstlnlafvaqifhernglnkdgkyafaemmtedvetcrdercyrlwinslgidsyvnnv fedvrngwillevldkvspssvnwkhaskppikmpfrkvencnqvikigkqlkfslvnvagndivqgnk klilgllwqlmrfhmlqllkslrsrtlgkemtdadilswanrkvrtmgrklqiesfkdkslssglffln llwaveprvvnwnlvtkgetddekrlnatyivsvarklgcsvfllpedivevnqkmililtasimywsl qrhsressdssstqsttttctstasspapsvteeeevsslsgevtslavgdavseittvseeasie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.2699
    Matthews' coefficent 2.90 Rfactor 0.2293
    Waters 190 Solvent Content 57.53

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pxy
    1. Structure of the actin crosslinking core of fimbrin
    MG Klein, W Shi, U Ramagopal, Y Tseng, D Wirtz - Structure, 2004 - Elsevier
     
    2. Phased translation function revisited: structure solution of the cofilin-homology domain from yeast actin-binding protein 1 using six-dimensional searches
    BV Strokopytov, A Fedorov, NM Mahoney - Section D: Biological , 2005 - scripts.iucr.org
     
    3. Opening of tandem calponin homology domains regulates their affinity for F-actin
    VE Galkin, A Orlova, A Salmazo - Nature structural & , 2010 - nature.com
     
    4. Drosophila melanogaster myosin-18 represents a highly divergent molecular motor with actin tethering properties
    SG Lendrum - 2011 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch