.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q2y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein YJCF from Bacillus subtilis: a member of the GCN5-related N-acetyltransferase superfamily. To be Published
    Site NYSGXRC
    PDB Id 1q2y Target Id NYSGXRC-T804
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8137,O31628 Molecular Weight 15667.14 Da.
    Residues 140 Isoelectric Point 5.64
    Sequence mkaviakneeqlkdafyvreevfvkeqnvpaeeeidelenesehivvydgekpvgagrwrmkdgygkle ricvlkshrsagvggiimkalekaaadggasgfilnaqtqavpfykkhgyrvlsekefldagiphlqmm kd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.265
    Matthews' coefficent 2.33 Rfactor 0.234
    Waters 36 Solvent Content 45.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q2y
    1. Selective prediction of interaction sites in protein structures with THEMATICS
    Y Wei, J Ko, LF Murga, MJ Ondrechen - BMC bioinformatics, 2007 - biomedcentral.com
     
    2. The molecular basis of glyphosate resistance by an optimized microbial acetyltransferase
    DL Siehl, LA Castle, R Gorton, RJ Keenan - Journal of Biological Chemistry, 2007 - ASBMB
     
    3. Radiation-induced site-specific damage of mercury derivatives: phasing and implications
    UA Ramagopal, Z Dauter, R Thirumuruhan - Section D: Biological , 2005 - scripts.iucr.org
     
    4. Structural characterization of proteins using residue environments
    SD Mooney, MHP Liang, R DeConde - PROTEINS: Structure, , 2005 - Wiley Online Library
     
    5. A fourier fingerprint-based method for protein surface representation
    MJ Bayley, EJ Gardiner, P Willett - Journal of chemical , 2005 - ACS Publications
     
    6. Uncover the conserved property underlying sequence_distant and structure_similar proteins
    J Gao, Z Li - Biopolymers, 2010 - Wiley Online Library
     
    7. Amino-acid-dependent main-chain torsion-energy terms for protein systems
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1206.3909, 2012 - arxiv.org
     
    8. Optimizations of protein force fields
    Y Sakae, Y Okamoto - Arxiv preprint arXiv:1208.6150, 2012 - arxiv.org
     
    9. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch